KEGG   Brugia malayi (filaria): Bm1_45630Help
Entry
Bm1_45630         CDS       T01050                                 

Definition
probable protein disulfide-isomerase
Orthology
K09582  
protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
bmy  Brugia malayi (filaria)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Bm1_45630
Enzymes [BR:bmy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Bm1_45630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 609 aa AA seqDB search
MLLRISLILIYLLECVSVEEKESEFQQNGGVFVLNERNFMSFLQQHPTALVEFYAPWCGH
CKALAPEYAKAAKKLKVPLAKVDATVETKLAETYNIEEFPTLKFWQNDKDPIVYDGGLES
NEIIQWVLEKTDPTYKAPPLAVAKLTKEKFSGFITLHQLVLVKFYAPWCGHCRKLAPEYE
KAARKLKSAGIMLAEVDSTVEKSLSAEFDITGYPTLYIFRNGKKFDYKGPRDTEGIVKHM
LEQAEPALRKINSVKEAQHFMRKDDITVIGFFSDGKAELLESLSEAAEMVRNDFSIAVCL
QVNTKKYFKIDSDQIVIFFPEIYWSKYESKQIVYQKACEDGTVEDLVRFFQENSTPLVGQ
RTKKNVATRYTKLPLVVIYYNIDFSVEYREGTQYWRKKVLDIANEYRKHKYHFAISDESE
FADELIAVGLGDSGLEHNVLVFGYDGKKYPMRPNEFDDELSENLQAFMKKLSSGKIKPFM
KSAPLPKDNKGPVKTVVASNFAQVVFDETKDVLMEFYAPWCGLCKAFESKYKELAVKLKS
ESNLLLVKIDATANDIPKNYDVSGFPTIYFAPAGKKKEPIKYKGNRDLDDLINFMKKHAS
ISFRSKIEL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgctgttaaggataagtctaatcctgatatatctgcttgagtgtgtatctgtggaagag
aaagaaagcgaatttcaacaaaatggtggtgtctttgttttgaatgagagaaatttcatg
tccttccttcagcaacatccaacagcactagtagaattttatgctccctggtgtggccac
tgtaaagcgctggcaccggagtatgcaaaggctgctaagaaactgaaggtgccattggct
aaagtggatgctaccgttgaaacaaaacttgcagaaacttacaacatcgaagaatttcca
acactaaaattttggcaaaatgacaaagatccaatcgtttacgatggaggattagaatct
aacgagattatacagtgggttttggagaaaacagatcccacttataaggcacctccgcta
gctgttgcgaaattaacgaaagaaaaatttagtggatttatcactttacaccaactcgta
ttagtcaaattctatgcgccatggtgtggtcattgtaggaaactcgcacctgaatatgaa
aaagctgcgagaaaattaaaaagtgcaggtataatgcttgcagaagtggattctacagtt
gagaagagtttatcagcggaatttgatatcactggctatccaacattgtacatcttccga
aacggaaagaaatttgattacaaaggacctcgtgatacagagggtattgtgaaacacatg
cttgaacaggctgaacctgctttaagaaaaattaacagtgtgaaggaggctcagcatttt
atgcgcaaagatgatataacagtcattggttttttcagtgatggaaaagcagaactactg
gaatctttaagtgaagcagctgaaatggtgcgaaatgatttcagtattgctgtttgtttg
caagtgaacactaaaaaatattttaaaattgattctgaccaaatagttatttttttccct
gaaatatactggagcaaatacgagtcgaagcaaattgtttaccaaaaggcatgcgaggat
ggtactgtggaagatttggtaagattttttcaagaaaattcaacacctcttgtgggtcaa
agaaccaaaaaaaatgttgccaccagatatactaaactccctcttgttgtaatttattat
aatattgacttctcagtagaatatcgcgaaggaacacaatactggaggaaaaaggtgtta
gatattgcaaatgaatataggaaacataagtatcattttgcaatttcagacgaaagcgag
tttgcagatgagcttatagcggtgggattgggtgacagtgggcttgagcataatgtttta
gttttcggttatgatggtaaaaagtacccgatgcgtccgaatgaattcgatgatgaatta
tctgagaatttacaagctttcatgaaaaaactatcttcaggtaaaataaaaccttttatg
aaatctgcgccattgccaaaagataataagggtccagtgaaaactgtcgttgcatcaaat
ttcgctcaggttgtgtttgatgaaacgaaggatgtgctgatggagttttatgcaccgtgg
tgtgggctttgtaaggcattcgagtcaaaatacaaagagttggcagtgaaattaaaaagt
gaatcaaatttgctacttgtaaaaattgatgcaacagccaatgatattccgaagaattac
gatgtgagtggttttccaacaatttattttgcaccagctggtaaaaagaaggaaccaatc
aaatacaaaggaaatcgtgacttagatgacctcattaacttcatgaaaaagcatgcctct
atttcgtttcgaagtaaaatcgaattgtag

DBGET integrated database retrieval system