KEGG   Brugia malayi (filaria): Bm1_46485Help
Entry
Bm1_46485         CDS       T01050                                 

Definition
MAP kinase sur-1
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
bmy  Brugia malayi (filaria)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
TGF-beta signaling pathway
Module
MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    Bm1_46485
   04012 ErbB signaling pathway
    Bm1_46485
   04350 TGF-beta signaling pathway
    Bm1_46485
   04068 FoxO signaling pathway
    Bm1_46485
   04150 mTOR signaling pathway
    Bm1_46485
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Bm1_46485
Enzymes [BR:bmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Bm1_46485
Protein kinases [BR:bmy01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Bm1_46485
Exosome [BR:bmy04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Bm1_46485
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 385 aa AA seqDB search
MTTTVEVQTKNGVEEVHGQVFEVGPRYVNLCYIGEGAYGMVVSALDTETHERVAIKKISP
FEHQTFCQRTLREIKILTKFKHENIINIQEIIRAPSVEQMKDIYIVQCLMETDLYKLLKT
QRLSNDHICYFLYQILRGLKYIHSANVIHRDLKPSNLLLNTTCDLKICDFGLARVTDPGH
DHTGVLTEYVATRWYRAPEIMLNSKGYTKSIDVWSIGCILAEMLSNRPLFPGKHYLDQLN
LILGVIGSPSQEDLQCIINEKARSYLLSLPHKIKQPWLRMYPNADPRALDLLDKMLTFNP
NKRISIEDALAHPYLEQYYDPNDEPVCEEPFTYEIEYDDLPKETLKQLIFKETEDHYRRT
QIAKKVTQLKEAELDPGINSTILSS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaacggtagaagtgcaaaccaaaaatggtgtcgaggaagtgcatgggcaagtt
ttcgaagttgggccacgttatgtgaatctttgctatatcggtgaaggagcatacggaatg
gtggtatcagcactggacacagagacgcatgagcgtgttgcaatcaaaaaaatctcacca
ttcgagcatcagacattctgtcagaggacgcttcgagaaatcaagattttaactaagttt
aagcatgaaaatatcatcaacattcaagaaatcatcagagcaccaagcgtggagcaaatg
aaagatatttacatagtgcaatgtttgatggaaacagatttgtacaagttgctgaaaacg
caacgactttccaatgaccatatttgttactttttataccagatattgcgtggattgaaa
tatattcattctgcgaatgttattcatcgtgatctcaagccatctaatttacttctcaac
actacttgcgatctcaaaatttgtgattttggccttgctcgagtaacagatcctggacat
gaccatactggagtattgacagaatatgtggcaactagatggtatcgtgcacctgaaatt
atgttaaattcaaaaggttatacgaaatctattgatgtgtggtcgattggttgtatctta
gccgagatgttaagtaaccgacccctttttcccggtaaacattatctggatcaattgaat
ttaatcttgggcgttattgggtcaccaagccaggaagatttacaatgcatcatcaacgag
aaggctcgatcatatttgctttcattgccacacaagataaaacaaccatggttacggatg
tatccaaatgcagatccgcgtgcactcgatttactagataagatgctaacttttaatcca
aacaaacgaatcagtatcgaagatgcccttgcacatccatatctggaacagtattatgat
cctaatgatgaacctgtctgtgaagaaccatttacttacgaaatcgagtatgacgattta
ccaaaagaaacattgaagcagctgatttttaaagaaacggaagatcattataggcgaaca
cagatagcaaagaaagtaacgcaattaaaggaagcagaattggatcctggaattaattct
acaatcttaagttcttga

DBGET integrated database retrieval system