KEGG   Brugia malayi (filaria): Bm1_46485Help
Entry
Bm1_46485         CDS       T01050                                 

Definition
MAP kinase sur-1
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
bmy  Brugia malayi (filaria)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
TGF-beta signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:bmy04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:bmy04012]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:bmy04350]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:bmy04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:bmy04150]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:bmy04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 385 aa AA seqDB search
MTTTVEVQTKNGVEEVHGQVFEVGPRYVNLCYIGEGAYGMVVSALDTETHERVAIKKISP
FEHQTFCQRTLREIKILTKFKHENIINIQEIIRAPSVEQMKDIYIVQCLMETDLYKLLKT
QRLSNDHICYFLYQILRGLKYIHSANVIHRDLKPSNLLLNTTCDLKICDFGLARVTDPGH
DHTGVLTEYVATRWYRAPEIMLNSKGYTKSIDVWSIGCILAEMLSNRPLFPGKHYLDQLN
LILGVIGSPSQEDLQCIINEKARSYLLSLPHKIKQPWLRMYPNADPRALDLLDKMLTFNP
NKRISIEDALAHPYLEQYYDPNDEPVCEEPFTYEIEYDDLPKETLKQLIFKETEDHYRRT
QIAKKVTQLKEAELDPGINSTILSS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaacggtagaagtgcaaaccaaaaatggtgtcgaggaagtgcatgggcaagtt
ttcgaagttgggccacgttatgtgaatctttgctatatcggtgaaggagcatacggaatg
gtggtatcagcactggacacagagacgcatgagcgtgttgcaatcaaaaaaatctcacca
ttcgagcatcagacattctgtcagaggacgcttcgagaaatcaagattttaactaagttt
aagcatgaaaatatcatcaacattcaagaaatcatcagagcaccaagcgtggagcaaatg
aaagatatttacatagtgcaatgtttgatggaaacagatttgtacaagttgctgaaaacg
caacgactttccaatgaccatatttgttactttttataccagatattgcgtggattgaaa
tatattcattctgcgaatgttattcatcgtgatctcaagccatctaatttacttctcaac
actacttgcgatctcaaaatttgtgattttggccttgctcgagtaacagatcctggacat
gaccatactggagtattgacagaatatgtggcaactagatggtatcgtgcacctgaaatt
atgttaaattcaaaaggttatacgaaatctattgatgtgtggtcgattggttgtatctta
gccgagatgttaagtaaccgacccctttttcccggtaaacattatctggatcaattgaat
ttaatcttgggcgttattgggtcaccaagccaggaagatttacaatgcatcatcaacgag
aaggctcgatcatatttgctttcattgccacacaagataaaacaaccatggttacggatg
tatccaaatgcagatccgcgtgcactcgatttactagataagatgctaacttttaatcca
aacaaacgaatcagtatcgaagatgcccttgcacatccatatctggaacagtattatgat
cctaatgatgaacctgtctgtgaagaaccatttacttacgaaatcgagtatgacgattta
ccaaaagaaacattgaagcagctgatttttaaagaaacggaagatcattataggcgaaca
cagatagcaaagaaagtaacgcaattaaaggaagcagaattggatcctggaattaattct
acaatcttaagttcttga

DBGET integrated database retrieval system