KEGG   Brugia malayi (filaria): Bm1_47310Help
Entry
Bm1_47310         CDS       T01050                                 

Definition
(RefSeq) acetyl-Coenzyme A synthetase 2
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bmy  Brugia malayi (filaria)
Pathway
bmy00010  Glycolysis / Gluconeogenesis
bmy00620  Pyruvate metabolism
bmy00640  Propanoate metabolism
bmy01100  Metabolic pathways
bmy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bm1_47310
   00620 Pyruvate metabolism
    Bm1_47310
   00640 Propanoate metabolism
    Bm1_47310
Enzymes [BR:bmy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bm1_47310
Lipid biosynthesis proteins [BR:bmy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bm1_47310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N DMRL_synthase
Motif
Other DBs
NCBI-GeneID: 6104347
NCBI-ProteinID: XP_001900923
AA seq 686 aa AA seqDB search
MSDARIKFEFPQMSAVKEDEEWFVPPAPILSGAHVTGIDSYREMYNNSINNADEFWRTVA
KELYFEETSKKGLEWNFDCRKGDIYVRFMEGARTNIAYNCVEQNIKKGYGSRTALLWEGN
EPGDCCSITFQDLFDKVVVFSAILRSHGVKKGDVVVIYLPMILELPIAMLSCARIGAVHA
VVFAGFSADALAARIRQTESRILITADGYYRGKKLVTLKMIADDALAECNVSGRPVEKVI
VVQHLKRVRKPDSTASIDVKLDPKRDVIWDKEMERCKGMNSEIEWNDAEDPLFILYTSGS
TGRPKGIVHTTAGYMTYTYATVKFVFDADPERDIYWCTADCGWITGHSYLVYGPLLNGLT
CVIYEGVPSYPTPSRMWQIVEKYKVTTLYTAPTAVRALMAFGDQYVTPYNRSSLRLLGSV
GEPINPVAWKWLHKVVGESRCVVLDTYWQTETGGHTITPLPAAIPCKXGSATLPFFGVEP
VIIDEEGREIEGAGKGTLCFKRAWPGISRSILGDHDRFMSTYFSPYPGYFFTGDGARRDA
DGYYWITGRIDDLMNVSGHLLSTAEIESALVSDNDVVEAAVVAAPHDIKGSFPYAFITLR
LGXKLTERKIEDLKLLVRKKIGAIAVPDVIQVAPGLPKTRSGKVTRRILRKIAEGDKAAD
LGDTTTLIDETVIAHLWSGRSETRTG
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatgctcggatcaaatttgagtttcctcaaatgtctgctgtaaaagaggacgag
gaatggtttgtccctccggcacctatccttagtggtgctcatgtcacaggaattgattct
taccgggaaatgtataacaactccatcaataatgccgatgaattttggagaacagtagct
aaagagctttacttcgaagagacgtccaagaaggggctggaatggaatttcgattgtcgt
aagggggatatttatgtgcgctttatggaaggtgcaaggacgaacattgcatataattgc
gtggaacaaaacattaagaaaggatatggctctcgcacggcgttgttgtgggaaggtaat
gagcctggtgattgttgttctattacatttcaagatctgtttgacaaagtcgtcgttttt
tctgctatcctgcgatctcatggagttaagaagggcgatgttgtggtgatttatttaccg
atgatacttgaattaccgatagcaatgttatcatgtgctagaatcggtgctgttcacgcg
gtagtgtttgctggatttagtgctgatgctttggcagctcgaatacgtcaaacagaatcc
cgtattctgatcactgcagatggatattatcgaggcaagaagcttgtaacactaaaaatg
atagctgacgatgctcttgctgaatgcaatgtgtcgggtagaccggtggaaaaagtcatt
gttgtgcaacatttaaaacgtgttcggaaaccggacagtactgcttccatcgacgtyaaa
ttagatccaaaacgggatgttatatgggataaagaaatggaacggtgcaaaggaatgaat
tctgagatagaatggaacgatgcagaagatcctctctttattctttacacttctggttca
acgggtcgaccaaaaggaatcgtgcatactactgctggttacatgacgtatacctatgct
actgtcaaatttgtttttgatgctgatccagaaagggatatatattggtgcacagctgat
tgtggctggattactggacactcgtatcttgtgtatgggccacttcttaatggtttgaca
tgtgttatatatgagggcgtaccgagttatccaacaccatcacggatgtggcagattgta
gagaagtacaaagttacaaccttatatactgcaccaacagcggtgcgtgctttgatggct
tttggcgatcaatatgttacaccgtacaatcgttcatcgctacgtttgctgggatcagtt
ggtgaaccaattaatccagtagcatggaagtggctgcataaggttgttggtgaaagtcgc
tgtgttgttcttgatacttactggcagacagaaacaggaggacatacgattacgccatta
ccggcagcaattccctgcaaasctggtagtgcaacacttcccttttttggagtagaaccg
gttattattgatgaggaaggtcgagaaatcgaaggagctggtaaaggaactttgtgtttc
aagcgagcttggcccggtataagtagaagcattttgggtgatcatgaccgatttatgagc
acatatttttcgccgtacccgggctacttttttactggtgatggagcacgtcgagatgct
gatggttactactggattacagggcgcattgatgatcttatgaatgtatcaggtcattta
ctgtctactgctgaaattgagtctgcrctagtttcggataacgatgtagtggaagcagct
gtagttgcggcaccgcatgacatcaaaggcagctttccatatgcattcatcacattacga
ttgggcrtaaaacttacagaaagaaaaattgaggatctgaaacttttggttcgaaaaaaa
attggtgcgattgctgtaccagacgttatacaagtagctcctggactacctaaaacacga
tcaggaaaggtaacacgtcgtatattacggaaaatcgctgaaggtgataaggctgcagat
ttaggcgacactactacacttattgatgaaacggttattgctcacttgtggagtggtcga
tcagaaacacggactggttga

DBGET integrated database retrieval system