KEGG   Brugia malayi (filaria): Bm1_47310Help
Entry
Bm1_47310         CDS       T01050                                 

Definition
acetyl-Coenzyme A synthetase 2
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bmy  Brugia malayi (filaria)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bm1_47310
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bm1_47310
   00620 Pyruvate metabolism
    Bm1_47310
   00640 Propanoate metabolism
    Bm1_47310
Enzymes [BR:bmy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bm1_47310
Lipid biosynthesis proteins [BR:bmy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bm1_47310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 686 aa AA seqDB search
MSDARIKFEFPQMSAVKEDEEWFVPPAPILSGAHVTGIDSYREMYNNSINNADEFWRTVA
KELYFEETSKKGLEWNFDCRKGDIYVRFMEGARTNIAYNCVEQNIKKGYGSRTALLWEGN
EPGDCCSITFQDLFDKVVVFSAILRSHGVKKGDVVVIYLPMILELPIAMLSCARIGAVHA
VVFAGFSADALAARIRQTESRILITADGYYRGKKLVTLKMIADDALAECNVSGRPVEKVI
VVQHLKRVRKPDSTASIDVKLDPKRDVIWDKEMERCKGMNSEIEWNDAEDPLFILYTSGS
TGRPKGIVHTTAGYMTYTYATVKFVFDADPERDIYWCTADCGWITGHSYLVYGPLLNGLT
CVIYEGVPSYPTPSRMWQIVEKYKVTTLYTAPTAVRALMAFGDQYVTPYNRSSLRLLGSV
GEPINPVAWKWLHKVVGESRCVVLDTYWQTETGGHTITPLPAAIPCKXGSATLPFFGVEP
VIIDEEGREIEGAGKGTLCFKRAWPGISRSILGDHDRFMSTYFSPYPGYFFTGDGARRDA
DGYYWITGRIDDLMNVSGHLLSTAEIESALVSDNDVVEAAVVAAPHDIKGSFPYAFITLR
LGXKLTERKIEDLKLLVRKKIGAIAVPDVIQVAPGLPKTRSGKVTRRILRKIAEGDKAAD
LGDTTTLIDETVIAHLWSGRSETRTG
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatgctcggatcaaatttgagtttcctcaaatgtctgctgtaaaagaggacgag
gaatggtttgtccctccggcacctatccttagtggtgctcatgtcacaggaattgattct
taccgggaaatgtataacaactccatcaataatgccgatgaattttggagaacagtagct
aaagagctttacttcgaagagacgtccaagaaggggctggaatggaatttcgattgtcgt
aagggggatatttatgtgcgctttatggaaggtgcaaggacgaacattgcatataattgc
gtggaacaaaacattaagaaaggatatggctctcgcacggcgttgttgtgggaaggtaat
gagcctggtgattgttgttctattacatttcaagatctgtttgacaaagtcgtcgttttt
tctgctatcctgcgatctcatggagttaagaagggcgatgttgtggtgatttatttaccg
atgatacttgaattaccgatagcaatgttatcatgtgctagaatcggtgctgttcacgcg
gtagtgtttgctggatttagtgctgatgctttggcagctcgaatacgtcaaacagaatcc
cgtattctgatcactgcagatggatattatcgaggcaagaagcttgtaacactaaaaatg
atagctgacgatgctcttgctgaatgcaatgtgtcgggtagaccggtggaaaaagtcatt
gttgtgcaacatttaaaacgtgttcggaaaccggacagtactgcttccatcgacgtyaaa
ttagatccaaaacgggatgttatatgggataaagaaatggaacggtgcaaaggaatgaat
tctgagatagaatggaacgatgcagaagatcctctctttattctttacacttctggttca
acgggtcgaccaaaaggaatcgtgcatactactgctggttacatgacgtatacctatgct
actgtcaaatttgtttttgatgctgatccagaaagggatatatattggtgcacagctgat
tgtggctggattactggacactcgtatcttgtgtatgggccacttcttaatggtttgaca
tgtgttatatatgagggcgtaccgagttatccaacaccatcacggatgtggcagattgta
gagaagtacaaagttacaaccttatatactgcaccaacagcggtgcgtgctttgatggct
tttggcgatcaatatgttacaccgtacaatcgttcatcgctacgtttgctgggatcagtt
ggtgaaccaattaatccagtagcatggaagtggctgcataaggttgttggtgaaagtcgc
tgtgttgttcttgatacttactggcagacagaaacaggaggacatacgattacgccatta
ccggcagcaattccctgcaaasctggtagtgcaacacttcccttttttggagtagaaccg
gttattattgatgaggaaggtcgagaaatcgaaggagctggtaaaggaactttgtgtttc
aagcgagcttggcccggtataagtagaagcattttgggtgatcatgaccgatttatgagc
acatatttttcgccgtacccgggctacttttttactggtgatggagcacgtcgagatgct
gatggttactactggattacagggcgcattgatgatcttatgaatgtatcaggtcattta
ctgtctactgctgaaattgagtctgcrctagtttcggataacgatgtagtggaagcagct
gtagttgcggcaccgcatgacatcaaaggcagctttccatatgcattcatcacattacga
ttgggcrtaaaacttacagaaagaaaaattgaggatctgaaacttttggttcgaaaaaaa
attggtgcgattgctgtaccagacgttatacaagtagctcctggactacctaaaacacga
tcaggaaaggtaacacgtcgtatattacggaaaatcgctgaaggtgataaggctgcagat
ttaggcgacactactacacttattgatgaaacggttattgctcacttgtggagtggtcga
tcagaaacacggactggttga

DBGET integrated database retrieval system