KEGG   Brugia malayi (filaria): Bm1_47660Help
Entry
Bm1_47660         CDS       T01050                                 

Definition
Carboxylesterase family protein
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
bmy  Brugia malayi (filaria)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Bm1_47660
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     Bm1_47660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 605 aa AA seqDB search
MMHPYFATFYLFLFTAIEIIYASRLSSKDETTVRTKLGIIRGIQQQFDDTFVNAYLGIPF
AQPPIGNRRFALPEMIEPWQGELEAQKPARTCYITPDSQFPQFPGAEMWNPPNVFDEDCL
ALNMWVPEKHDGKVMVWIYGGGFYSGSPSLDLYDGRVLASRQKTIVVNINYRLGPFGFLY
FGSRSSIPGNMGLMDQQLALRWIYENIASFGGDPNKITLFGESAGAASVTAHFFAPGSSP
LFPESSAHGELISLNFKSSGTIANSWAIKEKNMALQTSMFLAEKLNCTSGRNKHSDVHLI
EKCIRQASAANIQKAADAVGVDQVLPMTFPFVPVEEDEHFFKGNLFTKLKMRDFTKDISV
LIGSMKDEGTYWLPYYFLNPKMGFQFNHTISADDPSNRALINRAQYTCSIQSFIPYFDDS
QLVKHALLHAYEEISESKDPQERLRDGVARFIGDFFFTCSLIEFADILADNIYGSVYMYY
FTKRSSANPWPKWMGVMHGYEIEYVFGQPFRHSHLYAQSQLDSEKRFSETIMKYWATFAA
EGVPRPQWPKYNKVTRKAFVLNDKITGSNHQIDVDVHGKSCSLLSEAQAVDLEQFYQCKV
LFLLE
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgatgcacccgtactttgctactttttatctgttcttgttcacagcaatagagataatt
tatgccagcaggttatcatccaaagatgaaaccactgtccgcaccaaattaggcattatt
cgaggtatacagcagcaattcgatgatacatttgtaaatgcctacctcgggattccattt
gcccaaccacctatcggcaatcgaagatttgcattacccgaaatgattgaaccatggcaa
ggcgaattggaagcccaaaaacctgcccgaacatgttatatcactccagatagtcagttc
ccgcagtttcctggagccgaaatgtggaatccaccaaatgtatttgatgaggattgcttg
gcgctgaatatgtgggtaccagagaaacatgacgggaaagtaatggtttggatttatggc
ggtggcttctattctggctcaccatcgttggatctttatgatgggcgagtgcttgcaagt
cgtcaaaagacaatcgtcgttaacattaattacaggctaggaccgtttggtttcttgtac
tttggaagcagatcatcaatacccggtaacatgggcctaatggatcagcaacttgctttg
cgatggatttatgaaaatattgcctcatttggtggtgatccaaataagataacattgttc
ggggaaagcgcaggtgcagcatccgtgacagctcattttttcgcacccggaagctccccg
ttatttccagagagcagtgctcatggtgagttgatttcattaaatttcaagtcaagcggt
acgatagcaaattcatgggccataaaagagaagaatatggcactgcaaacatctatgttt
ttggctgagaaattgaattgtacttctggacgtaacaaacattcagatgttcatttgatt
gaaaaatgcatcagacaagcatctgctgcaaatatacagaaagcagcagatgctgttggc
gtggatcaagtgctaccgatgactttcccatttgtgcctgtcgaagaagatgaacatttt
ttcaagggtaatttatttacgaaattgaagatgcgcgattttactaaagatataagcgta
ttgatcggttcgatgaaagatgaaggcacatactggttgccctattactttctaaatcct
aaaatgggtttccagttcaatcatactatatcagctgatgatcccagcaatcgggcttta
atcaatagagcacaatacacatgttcaatccaatcatttattccttattttgatgattcc
caattagtgaaacatgcattgctacacgcgtatgaggagatatcggaaagtaaagatcca
caagaaagattacgagatggcgttgcacgttttattggagatttcttttttacgtgcagc
ttaatcgaatttgctgatattctagcggacaacatttatggctccgtctatatgtactat
tttacaaagaggtcttcagcaaatccatggccaaaatggatgggagtaatgcatggttat
gaaattgaatatgtatttggacaacctttcaggcatagtcatttgtacgcacaatcacag
cttgattctgagaaacgtttctcagaaacaatcatgaaatactgggctacctttgctgcc
gaaggtgttcccagaccacaatggccaaagtacaataaagtgacacgtaaagcattcgta
cttaatgataaaataacaggttctaaccatcagattgatgttgatgtacacggaaaatct
tgtagtttactctctgaagcccaagctgttgatctagaacaattttatcaatgtaaggta
ctattcttgctggaataa

DBGET integrated database retrieval system