KEGG   Brugia malayi (filaria): Bm1_47900Help
Entry
Bm1_47900         CDS       T01050                                 

Definition
Filamin/ABP280 repeat family protein
Orthology
K04437  
filamin
Organism
bmy  Brugia malayi (filaria)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:bmy04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1719 aa AA seqDB search
MRMYAQTASKGQDKSAHIKCVSLQLTMIEQQQDATWKRIQLNTFTRWVRQKLEQVDVTVS
DLETDFEEGLKLIRLVEVLSGKSFGRHNKKVIFRHQKLENISLALQFLENEEHIKLVNID
SSAIADRNLKLILGLVWTLILHYSISKQVWDHPSGQLGNGEMSAKEKLLTWLRAKLPVEL
SVTNFTFDWNDGILLGALVDSCAPDLEVDWRKWLPSQALQSTLTAMRLASDYLGVTALIE
PEELISPAVDEKSVMTYLSQFPGAKYTPLLGRLHDVVLRPVVGVSTIFKLQTRDAMIVPE
IIIKXPNGSSIRCIQRQLSETVYEFGYQPETPGEHEIMATVRDIASGDSAKLARTKVVAV
EGTDISSILVDGLNNETVTVGQRKDIVIDIGNLIPMKNGLEVIVEEIGKVDRSKYLLSLE
CERNSHIYRGFWTAERSGKTKICVLFDENVVCEYLISARHSEXITKCRALGEGLERAVVG
MPAKFLVDIKDAGKSKIEVAIKGPSEVKANVMDNLNGLCTVEYIPETPGLYEIMIYYGDK
KKQIPGSPFMVIADYERNPSKIVISGSTNGLAQARMPNSLIIDATLTALEPVSARLPAGF
EQPIVEEIKPRVYRVTFIPSITSETITLELLYGDELLGKPIVFLVKPEEELESVVLRNCS
GGLLSSTVQASLQFEALIDVTKAGKIDELFAEIKVRHFCNGPDGKVRKLLLTENSDKKIH
LLNFVPDLVGVYVIVIYINGEPFSDPYNLTAIPVGSADKCFVESKSLDKFWTIGEPRVFV
VNAKNGGEGALNVLSERVDLETKIDKNEDGSYTVTLTPHAQGQHRVMLMYGGVDIPGGTF
DFECIPSLVNEDRNISKQPVESEDNGHLMSRSFRFSVTSEYQFNKLTASVKMPSGTDDIA
YINDNRDGTVTVTYHPKECGSHLLSIKHDGINMSGSPISFHVNEANEEYATVYGLGLLQA
VVGEPAVFTVCAKGSPTKELSVAIEGTAKAVIKCHDNKDGTCSVVWIPSMAGEYKVHVKL
SGKPVKNSPFVVFVANEDQKRAHLSLEPTAMSEILINIDNAEIEDLSASVINPSGIEEPC
IIRQIDAAHVGISFSPCEVGEHLITIKKNEQVIQKSNFQAEIIRNQPGEASKVVVSGTGK
ANAICEQDNSVQINMRDAGFGDLSVSIQGPSEAELRCIENKEGVANIVYRPTEPGIYILS
VKFAGVHINDSPFRINCTGKGMGIVKESANKKVKQVPVVVPGQDTALYLQLKNISPLDTK
ARVVDPNGYSKDVKVCDLGDDLYRIEFKPVVNGPHAVSVLYKGQHISGSPFQFTVGHMKE
MGAHRVRAAGVKLKRAEASRKQSFNLYTREAGKGELEVTVEGPSKAELQFHEHEDGNCHF
DYKVAKPGEYLISVKFNAEHIPDSPFKVFIAPAAGEARCLELLSLSDSGTPGEICAIMIN
RNGAKGHLKAKLYTPANKIEAVDVLPVEGSDLCCVRFIPSETGDYYVDVTLDGAPMHDSP
FCFRIGTNGDNDPSIITVTGDGIHGGQTGQICTFIINTYNAGAGLLHILISGPSKVTMNA
CEVSVYSFSFHFAVSHFQAGVHIPSSPFKVVVEGKKLDDGKPDFSLIKIDAFPKIKKEVV
HRVPILSGDANKVIVKGSGLSKFFPGQSAVFNVDTGLAGDNILYVGLLTSKGPCEQVALQ
HLGNGQYVVKYLIQEEVKGFIYIKYGDVDVPGSPFAVSF
NT seq 5160 nt NT seq  +upstreamnt  +downstreamnt
atgcggatgtatgcgcagactgcatcaaaaggacaggacaaatccgctcatatcaagtgc
gtttcattgcagttaactatgatcgaacagcaacaggacgcaacgtggaagagaattcaa
ctgaatactttcactcgatgggttaggcagaaattagaacaagtggatgtaacggtgtct
gatttggaaaccgattttgaagagggtttgaaattaatacgtttggttgaagtactttct
gggaagtcgtttggtcgacataataaaaaggtcatatttcgtcatcagaaacttgaaaat
atctcgcttgcgctgcaatttttggagaacgaagaacacataaaacttgttaatatcgat
agttctgcaatagcagaccgcaatctgaaactgattttgggtctcgtatggacgcttatt
ttacattattccatttcaaaacaagtttgggaccatccaagtggtcaattaggaaatggt
gaaatgtcagcgaaagaaaaactcttgacatggctcagagcaaagttaccagtcgaactt
tctgtaaccaatttcacctttgattggaacgatgggattctccttggtgctttggttgat
tcttgtgctccagatttggaagttgattggcgaaaatggttaccatcgcaggctttgcag
tcaactcttactgcaatgaggcttgctagcgattatcttggtgttactgcacttattgaa
ccagaggaattgatcagtccggctgttgatgagaaaagtgttatgacttatctttcgcag
ttccctggtgcgaagtatactccattacttggtcgacttcatgatgttgtgttgagacca
gtagtaggagtcagcacgatatttaaactccaaactcgtgatgcaatgatagttccggaa
atcattatcaaagrgccgaatggatcttcaattcgttgtattcaacgtcagctttcagaa
actgtttatgaattcggatatcaaccagaaacaccaggcgaacatgagattatggcaaca
gttcgtgacattgcatctggtgactcagctaaactggcaaggaccaaagttgtagcagtt
gaaggaacggatatctcttcgattttggtggatggtctcaataatgaaactgtaacagtt
ggacagaggaaagatattgttattgatattggaaacttgatacctatgaagaatggtttg
gaagttattgtggaggaaattggaaaagttgatagatcaaagtatttgctatctttagaa
tgtgagcgtaattcacacatttacagaggcttctggacagccgaaagatcagggaaaacc
aaaatatgtgttctttttgatgaaaatgtagtttgtgaatatctaattagtgctcgacac
agcgaggamataactaaatgccgagcccttggtgaaggacttgaacgtgctgttgttggt
atgccagcgaaatttctagtcgatataaaggatgctggaaaaagcaaaatagaagtagcg
atcaagggaccctcagaagtgaaagcgaatgtaatggataatttgaatggtttgtgcaca
gtggagtacattccagaaactcctgggttgtatgaaataatgatttattatggagacaaa
aaaaaacaaatcccaggttctccattcatggtaatagccgattatgagcgtaatccatcg
aaaattgtaataagcggaagcactaatggactagctcaagctagaatgccaaattcgctt
attattgatgctacgcttactgcattagaaccagtaagtgcgcgtcttcctgccggtttc
gaacagccaattgttgaagaaatcaaacctcgagtatatcgagttactttcatcccaagc
attacaagtgaaacaataacattggaacttttgtacggggacgaacttcttgggaaaccg
atagttttcttagtcaaacctgaagaagaattagaatccgtggtattgagaaattgttct
ggtggcttgctatcgtcaacagtgcaagcctcccttcagtttgaagctctgatcgatgtt
acgaaagctgggaaaattgatgaactgtttgcggaaataaaagtgagacatttttgtaat
ggtccagatggcaaggtgcggaaattactactcaccgaaaactctgacaagaaaatacac
ttattgaacttcgtgccggacttggtaggggtatatgttattgtaatatacatcaatggg
gaaccattttcggatccgtataacttaactgctataccagtgggttcagcagataaatgc
ttcgtggaatcgaagtcacttgacaagttctggactattggggagccaagagtttttgta
gtgaatgctaaaaatggaggagaaggagcattgaacgttctctctgaaagagttgacttg
gaaacaaaaattgacaagaatgaggatggctcttacactgtaacacttacgccacacgct
caaggacagcatcgagttatgttgatgtatggaggtgttgatatacctggtgggacattc
gattttgagtgtattccatctcttgtgaatgaagacaggaatatttctaaacagccagtg
gagtctgaagataacggacatctgatgtctcgcagttttcgtttttctgttacttcggaa
tatcagtttaacaaacttactgcttccgttaaaatgccttctggtacagatgatatagcc
tatattaacgacaatagggatggaactgtgacggttacatatcatccgaaagagtgtggc
agtcatttgttgtcaataaaacacgatggcattaacatgtctggaagtccaatttcattt
catgtgaatgaagcaaatgaggaatatgcgacagtatatggtcttggcttattacaggcg
gttgtcggtgaaccagcagtatttacagtttgtgcgaaaggttcacccactaaagagttg
tctgttgctattgaaggtacagcaaaagctgtaatcaaatgtcatgataataaggatggc
acatgttctgtagtatggataccctctatggctggagaatacaaagtacatgtgaaactt
tccggaaaaccagtgaaaaattctcccttcgttgtatttgtggcaaatgaagatcaaaag
cgagcgcatttgtcccttgaaccaacagcaatgtcggagatcttaattaatattgacaat
gctgaaattgaagacctgtcagcatcagtaataaatccaagtgggattgaagagccatgc
atcatccgtcagattgatgcagcccacgtcggtatctcattctctccatgtgaagtgggt
gaacatttgatcactattaaaaagaatgaacaggttatacagaaatcgaatttccaagct
gaaattattagaaaccaacctggagaagcgtctaaagttgttgttagtggaacaggtaaa
gcaaatgctatttgtgagcaggacaacagtgtacaaatcaatatgcgtgatgctggtttt
ggtgatttgtctgtatcaattcagggaccgtcggaagctgaattaaggtgtattgaaaat
aaagaaggtgtagctaatattgtttatagacctaccgaacctggaatttacattttgtct
gtaaaatttgctggcgttcatataaatgatagtccgttcaggattaactgcaccggaaaa
ggaatgggtatcgtgaaagaaagcgcaaataagaaagtgaaacaggttccagtagttgta
cctggacaagacactgccctgtatttgcaattgaaaaacatatcaccattggacacaaaa
gcaagagtcgttgatcccaatggatacagcaaagatgttaaagtttgtgatcttggtgac
gatctttatcggattgaattcaaacctgtagtgaatggtccacatgcagtttctgttctg
tataaaggacaacatatttcaggcagtcccttccagttcaccgtaggacatatgaaagaa
atgggtgcacatagggtacgggcagcaggagtcaaattgaagcgagcagaagctagcagg
aaacaatctttcaatctttatacccgagaggctggaaaaggagaacttgaagtaacggta
gaaggaccatcaaaagccgaattacagttccatgaacatgaggatggaaattgccatttc
gattataaagttgcgaagccaggagaataccttatatcagtcaaattcaatgctgagcat
ataccggattcaccattcaaagtgtttattgctcctgcagctggggaagcccgctgcttg
gaattactatcactctcggattctggaacaccaggtgaaatatgtgctattatgataaat
aggaatggtgcaaaaggtcatcttaaagcaaagctttatacaccggccaacaagattgaa
gcagtcgatgtcctcccagttgagggaagcgatttgtgctgcgtccgattcattccttca
gagactggagactattacgttgatgtaacgcttgatggtgcacctatgcatgactcacct
ttctgtttccgaattggcacaaatggcgataatgatccatcaataataactgtgactggc
gacggtattcacggtggtcaaactggccaaatctgtacatttattatcaatacttataat
gctggagcaggacttctccatattctgattagtggaccatcaaaagttactatgaatgca
tgtgaagttagcgtttattcattttcatttcatttcgctgttagtcattttcaagcaggt
gttcatattcctagttccccgttcaaggtagttgtggaaggtaaaaaacttgatgatggc
aaaccagacttttcattaatcaagattgatgcgttccctaaaattaagaaagaagtagtt
catcgagttccaattctttccggagatgcgaacaaagttatagtgaagggttctggtctc
agtaaattttttcctggtcagtcggcggtcttcaatgtcgacactggtctcgcaggagac
aatattttgtatgttggtctacttacatcgaagggaccttgtgaacaagttgcactacaa
catcttggtaatggccaatatgtagtcaagtatcttattcaggaagaggtcaaaggtttt
atttatatcaaatacggcgatgtggatgtgccaggctcaccgtttgctgtttccttttaa

DBGET integrated database retrieval system