KEGG   Brugia malayi (filaria): Bm1_48125Help
Entry
Bm1_48125         CDS       T01050                                 

Definition
Phosphatidylinositol 3- and 4-kinase family protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
bmy  Brugia malayi (filaria)
Pathway
ErbB signaling pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    Bm1_48125
   04150 mTOR signaling pathway
    Bm1_48125
Protein kinases [BR:bmy01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   Bm1_48125
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 2475 aa AA seqDB search
MDSCIRETSARAIAADFLMRLRKKGGDENRLKVARQLYDYINGELRDSSDQFAAEFFATF
DAKVDQSAIHTLMTSLDNDERKAGIILIACLVENAGDETKRVPRFAKYLLKALVQGDEAG
MKLVARAIAYLIQTSKTFAAELVEKSINQVCEWLEESERHESRRLAAVFLARQLALYTST
SFFLRASNFFSNIFKVIRDPKATVRIAATKALHAALTVTSQREAHQKSEWYWRCYDEAIN
SLKFDGLNRDERQHPMLLILNELLRIGNAPAERQRILALGCQPQQNVRTVIGSNAIDWLT
ERTYSVTVDSRTANQLIAEKFSDIYRVCNLACTSRYVCCQTTLLEIFPRLSSFGKTQMVT
SNNIFNVDIASMFNHALNLTTKHSPAFFTLGLLVLDRPIELLLKLPRLFAVIQIQLQTAT
YKHKAVDEYVFLCLTLVIRALKEKIESEIKTLLPILLSTGLSKGLTDVAYEIMQSIPGLK
TEAQDGLLKELCQLLMNRKLPSKLDPPTEPPIPVGPVNVTNVALTNLALATLGRFEFQRH
ALQMFINYIAHGYLSSDCVEVRLAAVDCCAKMLTPFVRVFESFECANKKQRFDVLNLIQS
VLRQLVMVAVIDPSVEVRLRVLQCFKDGDPLLLSHLAQADMLDSIFMTLHDEKLEMQEHA
VALLGKLGSMNPAYVLPSLRNVLLETLIQLTNSGVPRLEEHSARVIAQVAKQSPKFARPY
MNPILTALVPKLSSEISHVDVTVQVLNAISELAVAGGADLAALRTMGQLCQNTAYVVDPY
KEHPELLDVLLRLLRTEMSVSMRRMTMRVLGIIGALDPYTHKVFTGKVSSQKSNSLALSL
PATSPSLDMRNDTIQWFHYEKCTLAELYPAFSIASLMQMLRDDSLSHLHRDITQALLTIF
GSLGPSCTVYVSKVIPRLIEVIQTATRPDLKQFYLQQLANFIAIVGSSMKPFMSKLFSLI
RESWSEDVSMRLTIVNVMQQIGSAFGASFAPYIPELCPYLLSIVHSDRTKDRAITCAVFT
CVQSISMCLAPHIHLVLPPILFVLDDRSVKVEVRRIALDTVYQMAETICIRDHAPRIMQV
WLRVISVHALQQKLLLLLVVIVRQMWRQFLVFRKSVDYALARHNLHCDEYLKLTVQLDEG
SAASPSHFPSVRVSSSQVKQFSTSARHEKGQRINFDVLKRTWTTAQLVSKEDWDQWLVLL
RIQFIRQSPSAALRACAPLADVHISLAKDLFNAAFMSVWTDLDEMQQRDLETNLKYALDS
SNHTDIIQTILNLAEFMEHSEKGPLPVGSERLCKCAEQTRAYAKALRYTELNIREKFNRD
PDPEHCRSLITYANKLNLQEEAAGIVAFARQHNMEIGRQGRWYEKLNEWEKALEIYNNET
FITDEVRLYEHQMRCLEALGQWAELNDLGKKAFAEVAAAASATRRQNMAITAARGSWAIE
DWETMDYYVKQINENNQDGSFLRAVLAIRNEQYHDALVYIEKVRDMCDTELTAMASESYE
RAYGAMILVQQLTELEEAIEYKMWPDRRIRIAVVWSRRLQGCRPNIEQWQRLLLVKSLVL
SRNEMRPLWIKFSSLCRQYGKLSMSRRILADLLGLKRNEELHEISDLPMDKPSLVLAVCK
QYWAENLNELACNTLEKLINQFEVDKREVKKNSEMCRLMAKCCLKLGDWYDILPQPTKDI
QTMNINVQQSLQPISISQQSPTNSSIMINVPPLLLPSSYVQISPPPVIPPSSHVMQSLQS
SLSQAPLTQTMKFYANATVYDPTWYKAWHKLASAYFNAAMYQTQNSFSPAPPPPPFIGAM
PSSPSYSPFGSIIDRDILSDILIPELYPQPPPSDAVIVNPPSPAPNKAMIFFAKQAVSSF
INAVTLAEGSRLEDTLRFLTLWFKHGDQVEVFETIKESLKLLPVEMWLEVIPQLMARLDS
KQNVAQLIKEVVIDLSKVHPQSLVYALTVAAKSANLRRSAVATEILTIMSDSQSTLVEQA
RLVSDELIRCAILWHEQWHEALDDASRLYFQDKNVKAMFDLLKPLHDLIDRGATTLKEQS
FKQTYENELKEAWNACRCYLRSQNAKELNQAWDLYYIVFRKISSQLRQLTSLDLNYVSPR
LVKARDLELAVPGTYDPSAPLVTISSINNTLQVINSKQRPRKVVMKGSDGKDYIFLLKGH
EDPRQDERVMQLFGLVNTLLLHQGDTSRRNLTIQRYSIIALNQNSGLIGWVPNCDTLHSL
IRDYREKKGILLSMEHKIMQSFAHDLDQMTLLQKVFHHALEMTSGNDLQQILWLKSPNSE
IWFDRRTNYTRSMACMSMVGYILGLGDRHPSNLMLDRISGKIVHIDFGDCFEVAMTREKF
PEKIPFRLTRMLIQAMEATGIEGNYRITCERVLRVLRSNKESLLAVLEAFVYDPLINWRL
MEAGGRRPPPETLQKDGQTDSKAESSLKRIKQKLAGRDFNPNVEFSIPEQVSLLIEQAVL
AENLCQCYIGWCPFW
NT seq 7428 nt NT seq  +upstreamnt  +downstreamnt
atggattcatgtattcgagagacatctgcacgagcgatcgcagctgattttcttatgcgt
ttaaggaagaaaggaggtgatgaaaatcgattgaaagttgccagacaactttatgactat
ataaatggggaattacgtgatagcagtgatcagtttgcagcggaattttttgcaacattc
gatgcaaaagttgatcagagtgctatacatacgttgatgacgagtttggataatgacgaa
agaaaggcaggaattattttgatagcttgtctggtggaaaatgctggtgatgaaacaaaa
cgtgtcccacgttttgctaaatatcttctcaaagcactagtacaaggcgatgaagctggt
atgaagcttgttgccagggcaattgcttatttgattcagacgtcgaagacattcgctgct
gagctagtcgaaaaatccattaaccaggtgtgtgaatggcttgaagaatctgagcgacat
gaatcacgtcgtcttgctgctgtttttctggcaagacaattggccttatatacgtcaaca
tcattttttctgcgtgcatctaactttttttccaatattttcaaagttatcagagatcct
aaggccacggtacgaatagcagctactaaggctttgcatgctgcccttacggttacatca
caacgcgaagcacatcagaaatctgaatggtactggcgctgttatgatgaagcaataaat
tctttgaaatttgacggtttaaatcgagatgaaaggcaacatcccatgcttctgatactg
aatgaactacttcgaattggtaatgcaccggctgagcgtcaacgcatcctagcgcttggt
tgtcaaccacagcagaatgttcgaacagtaattggatcaaatgcaatagattggttgacg
gagcgcacatattcagttactgttgatagtcgaactgctaatcagcttattgcagaaaaa
tttagtgacatatatcgggtgtgtaatctggcatgtacttcacgttatgtttgttgccaa
acaacattgcttgaaatttttccacgtctttcatcatttggaaagacgcagatggttact
tcaaataatattttcaatgttgatatagcttcaatgttcaatcatgcattaaatttgact
acaaaacattctcctgctttctttactcttggtttgttggtacttgatcggccaatagaa
ctgcttttaaaactacctcgtctttttgctgtcatacaaattcagttacaaactgcaacg
tacaagcacaaagcagtggatgaatatgtcttcttatgtttaacattagttattcgcgca
ttaaaagaaaaaatagaatccgaaattaaaacgctattgccgattttattgtccacaggt
ttatcaaaagggttaacggatgttgcttatgaaataatgcagtccatacctggattgaaa
acggaagcccaagatggtttgttgaaagagctttgtcagcttttaatgaatcgcaaattg
ccaagtaaacttgatcctccgacagaaccgcccattccagttggtcctgtgaatgttact
aatgtggcgcttacaaatcttgctttagctacacttggtcgtttcgaatttcagcgacat
gcacttcagatgtttataaattatatagctcatggctacttgtcttctgattgcgtagaa
gtacgtttagctgcagtggattgctgcgccaaaatgttgacgccctttgttcgtgtattt
gaatcgtttgaatgtgccaataaaaaacagcgtttcgatgtcctaaatttaatccagtct
gtacttcgacaacttgttatggttgccgttattgatccatcggtggaagtacgcttgaga
gttttgcagtgtttcaaagatggggatccacttctgttgtcgcatttagcgcaggctgat
atgcttgattctattttcatgactttgcatgatgaaaagctggaaatgcaggaacatgcg
gtagcgttactcggaaaactaggcagtatgaatcctgcatatgttttacccagtttacgt
aatgtactgttggagacacttatccaactgacgaatagtggtgtrcccagactcgaagaa
catagtgctcgtgtaattgcacaggttgctaagcagtctccaaaatttgcaaggccctat
atgaatccgatactgacagctttggtaccaaaactgagctccgaaatcagtcatgtggat
gtgactgtgcaggtattgaatgctataagtgaattggcagttgcgggtggtgctgatttg
gctgctttgcgcacaatgggacagctttgccagaatactgcatatgtcgttgatccatat
aaggagcatcctgaattgcttgatgtacttctgagattgttacgaacggaaatgagtgtt
tcaatgcgtcgaatgaccatgcgggttttgggtattattggagccttagatccttataca
cataaagttttcactggcaaagtttcttctcaaaagtcgaattcgttggctctgtcatta
ccagctacatcaccatccttggatatgcggaacgatactattcaatggtttcactatgaa
aagtgtacattagcagaactctatcctgcattttctatagcaagtttaatgcagatgcta
agagacgattcactcagccatttgcatcgtgatatcacgcaagcactacttactatattc
ggcagccttggtccaagttgcactgtctatgttagcaaggttatacctcgcctgattgaa
gtaattcaaacagctactcgacccgatttgaagcagttttatttacaacagttggctaat
tttattgcgatagttggcagtagtatgaaaccattcatgtcgaaattgtttagtttgatt
agagaatcatggtcagaagatgtgagcatgcgacttactattgttaatgtcatgcaacaa
attggctcagcatttggtgcatcatttgcaccatatattcctgagttgtgtccatatctt
ctgagtattgttcattcagatcgtacgaaggatagagccatcacttgcgctgtattcaca
tgcgttcagtcaatatcgatgtgtctggcaccacatattcatcttgttttgccacctatt
ttgtttgttctcgatgatcggagtgtcaaagtggaagtgcgacggattgctctggataca
gtttatcagatggctgaaaccatttgtattcgtgaccatgcaccgagaataatgcaagtc
tggttacgagttatttctgtccatgcactacagcaaaagttattacttttattagtggtt
attgtccgacagatgtggagacagtttctggtttttcgtaaaagtgttgactatgctctg
gctcgacataacttgcactgcgacgaatatttaaagcttactgtacaacttgatgaggga
agcgctgcatctccttcacactttccttcagtcagagtttcttccagtcaagtaaagcag
tttagtacatccgctcgtcatgaaaaaggacagcgaattaattttgatgttttaaaaagg
acttggactactgctcaacttgtatcgaaggaggactgggaccagtggcttgttctactg
cgaattcaatttattcgacagagcccttccgcagctcttcgcgcatgtgctcctttagcc
gacgtgcatatatcgcttgcgaaagacctgttcaatgcagcatttatgtcagtttggaca
gatctggacgaaatgcagcagagagacttggagacgaaccttaaatatgctcttgattcc
agtaaccatactgatatcatacaaacaatacttaaccttgcagaatttatggaacattcc
gaaaaaggacctttaccggttggtagtgaaaggctctgtaaatgtgcggaacagacacga
gcatacgctaaagcgttacggtatacagaattgaatattcgcgagaaatttaacagagat
ccagatccggaacactgccgctctcttattacttatgcaaacaaattgaatctccaagaa
gaagccgctggaattgtggcatttgctcgacagcataatatggaaattggaaggcaagga
cgttggtatgaaaaactgaatgaatgggagaaggcattggagatatataacaatgaaaca
tttattactgatgaggtccgactatacgaacatcagatgcgatgtttagaagcattagga
cagtgggctgaattaaatgacttaggaaaaaaagcgtttgcggaagtggctgcagcagca
agtgcaactagaaggcaaaatatggcaataactgcagcgcgaggtagttgggcaatcgaa
gactgggaaacaatggattattatgtcaaacagattaatgaaaataatcaagacggatcc
tttcttcgagctgtgctggctattcgaaatgaacagtaccatgatgcattggtttacatt
gaaaaggtacgtgacatgtgcgacacagaattaacagctatggcatcagaaagttatgaa
agagcttatggtgcaatgattcttgtacagcaactaaccgagttagaggaagccattgaa
tataaaatgtggcctgatcgaaggattcgaattgctgttgtttggagtcgacgtttgcaa
ggatgccgaccaaatattgaacagtggcagaggctgctgctggtaaaatcattagtgctt
tcacggaatgaaatgcgcccactgtggattaaattctcatcactttgccgacaatatggg
aagctatcaatgtcacgtcgaattttggcagatttattaggactaaarcgaaatgaagaa
ttacacgaaatatcagatttaccaatggataaaccttcattggtgctggcagtttgtaaa
caatattgggcagaaaacttgaatgaactagcatgcaatacattggaaaagctgattaat
caatttgaagtcgacaagagagaagtcaagaaaaattcggagatgtgccgtttgatggca
aaatgttgtttaaaacttggtgattggtacgatatcctaccgcagccaaccaaagatata
caaactatgaacataaatgtccaacaatcattacaacctattagcatctctcaacaatca
ccgactaattcatccattatgattaatgtaccaccactacttctacctagtagttatgtc
cagatttctccgccaccagtaattccaccaagttcacatgtgatgcaatcgttacagtcc
agtttatcacaagctcctttgacgcaaacaatgaaattctatgcaaatgctacagtttat
gatccaacttggtataaagcatggcataaacttgcgtctgcgtactttaatgctgctatg
tatcagacacaaaattcgttttcgccggcaccaccaccaccgccttttatcggtgcaatg
ccaagttctccctcctacagcccctttgggagcattattgatcgagatattttatcagat
attttgataccagaactttatccacagccgccgccttctgatgcagttattgtaaatcca
ccttctccagcacctaataaggcgatgatcttttttgcaaaacaggctgtctcaagcttt
attaatgctgttaccttggctgaaggatcacggctagaagatacactgcgatttctaact
ttatggttcaaacacggtgatcaagttgaagtttttgaaactatcaaagaatcgctgaag
ctgttgcccgttgaaatgtggctcgaggttatcccacaattgatggcacgtttagattcg
aaacaaaatgtcgctcagttaatcaaagaagttgtcatcgacttatcgaaagttcaccca
cagtctttggtttatgcccttacagtggctgcgaaatcggctaatttacgccgttctgca
gttgcaacagagatattaacgattatgagcgatagccaatcaacacttgttgagcaagca
aggcttgtcagtgacgaattgattcgttgtgctatactatggcatgaacagtggcatgaa
gcactcgacgatgcgtcgaggctttattttcaggacaagaatgtaaaagctatgttcgac
ctgttgaaaccattacatgacttgatcgatcgtggtgctactactctgaaggaacaatct
ttcaaacaaacgtatgagaatgagttgaaggaagcttggaatgcttgtcgttgctattta
cgttcacagaacgccaaagaactcaatcaagcatgggatctctactacattgtatttagg
aaaatctcaagtcagcttcgtcagcttacatctttggatctcaattacgtttctcctagg
ctggtgaaagctagagatttggaactagcagttcctggaacatatgatccaagtgctcca
ttggttactatatcctcgataaataatactttgcaagtaattaattcaaaacaacgacca
agaaaagtagttatgaaaggaagtgatgggaaagattacatattcctcctgaaaggtcat
gaggatcctcggcaagacgagagagtgatgcagctgtttggtttggtcaataccttgctc
ttacatcagggtgatacatctcgccgaaatttgacaattcaacgctattcaattattgcc
ttgaatcagaatagtggtttgattggttgggtgccgaactgtgatactttacactcgctt
attcgtgattatcgggaaaagaaggggattctcttatctatggagcacaaaattatgcaa
agttttgctcatgatttggaccagatgactttattgcaaaaagtattccatcatgcactt
gaaatgacgagtggaaatgatttacaacagattttgtggcttaaatctccaaattcggaa
atttggtttgatcggcgtaccaattacactcgctcaatggcatgtatgtcaatggtgggc
tacattttgggacttggggaccgacatccgtcaaatctaatgctcgatcgcattagtggg
aaaattgttcatattgatttcggtgattgcttcgaagttgcaatgaccagagaaaagttt
ccggaaaagattccatttcgactaacaaggatgctcattcaggcgatggaagctacagga
attgagggtaattatcggataacctgtgagcgtgttttacgggtgcttcgttcaaataag
gaaagccttcttgcagtcctcgaagcatttgtgtatgatcctcttatcaattggaggttg
atggaagctggtggaaggcgaccacctcccgaaacacttcagaaggacggtcaaactgat
tccaaagctgagtcatctctaaagcgtatcaagcagaaattagctggccgtgattttaat
ccaaatgtggaattcagtataccggagcaagttagtctgctcattgaacaagcagtctta
gcggaaaacttgtgtcagtgctatatcggctggtgtccattttggtaa

DBGET integrated database retrieval system