KEGG   Brugia malayi (filaria): Bm1_48320Help
Entry
Bm1_48320         CDS       T01050                                 

Definition
Lecithin:cholesterol acyltransferase family protein
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
bmy  Brugia malayi (filaria)
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Bm1_48320
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Bm1_48320
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Bm1_48320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 409 aa AA seqDB search
MALIFSIMISATICATKGKPLHPIVLVPGYGGSQLKGKLTGKPETVHYWCARQTDDFFDL
WLNLELFLPTVIDCWVDNMKLVYNRTTNKTSSMPGVLVEVPGFRNTSTIEWLDTSKASEG
RYFTDIVEALLPFGYHRGKNIVGAPYDWRQAPNELGHYYSNLTKLIEDIYRSCGHRKVII
IAHSMGNPLLLYFYNSIVTQEWKDKFIHSHISIAGAWGGALQIIRLLASGECVSYNMNHY
RILLPPSSLREMQRSFTSSTFLFPSYNVWSENEVLATVNDKNYTLKNVEEFFKDIGYKVG
WYQYQNTAHLLGDFQAPNIEVHCIYGYGIETPESFEWSGRWFPDYQPDTTYGDGDGTVNR
RSLEACKKWIGKNGGKKISLYAFKGGEHVDILAQEEVIELIKKIVFMHS
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggcgttaattttttcgattatgatatcagcaacaatttgcgcaacaaaagggaaacct
ttgcatccaattgtattagtacccggttatggcgggtcgcagttgaagggaaagcttact
ggaaaacctgaaactgtgcactactggtgtgctcgacaaacggatgatttcttcgatctg
tggctaaatttagagttattcttgccaacggtaatcgattgttgggtggataatatgaag
ttggtatacaatagaacaacaaacaaaacatcaagtatgccgggtgtactggtcgaggtg
cccggattccggaatacaagtaccatagaatggttggacacatcaaaagcgtcggaagga
cgctatttcactgatatcgttgaagcattgttaccattcggttatcatcgaggtaaaaat
attgtaggtgcaccatatgattggagacaagctccaaatgaactcggacactattattca
aatttgacaaaattgattgaagacatctatcgttcttgtggtcacaggaaagtgatcatt
attgcgcatagcatgggtaatccactgttgctttacttttacaacagcatcgtcacacag
gaatggaaggacaaatttattcattcgcatatttcgatagctggcgcttggggcggtgct
cttcaaattattcgtcttcttgcttcaggtgaatgtgtaagctataatatgaaccactac
agaattttactacctccaagctcactgcgtgaaatgcaacgatcattcactagttcgaca
ttcctttttccgagctacaatgtatggagtgaaaacgaagtgctggcaacagttaacgat
aaaaactacactctgaaaaatgtggaagaattctttaaagatattggctataaagttggc
tggtatcagtatcagaatacagctcatctacttggcgatttccaggcaccaaatattgag
gtgcattgtatttacgggtatggcattgaaacaccagaatctttcgagtggtccggcagg
tggtttccggattaccaaccggataccacttatggtgatggtgatggtaccgttaaccga
cgttctctagaagcatgcaagaaatggattggtaaaaacggtggcaaaaagatatctctg
tatgcgttcaaaggtggcgagcatgtggacattttggcacaggaggaagtaatcgaatta
attaaaaagattgtctttatgcatagctaa

DBGET integrated database retrieval system