KEGG   Brugia malayi (filaria): Bm1_48320Help
Entry
Bm1_48320         CDS       T01050                                 

Definition
Lecithin:cholesterol acyltransferase family protein
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
bmy  Brugia malayi (filaria)
Pathway
Glycerophospholipid metabolism
Lysosome
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bmy00564]
Cellular Processes; Transport and catabolism; Lysosome [PATH:bmy04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 409 aa AA seqDB search
MALIFSIMISATICATKGKPLHPIVLVPGYGGSQLKGKLTGKPETVHYWCARQTDDFFDL
WLNLELFLPTVIDCWVDNMKLVYNRTTNKTSSMPGVLVEVPGFRNTSTIEWLDTSKASEG
RYFTDIVEALLPFGYHRGKNIVGAPYDWRQAPNELGHYYSNLTKLIEDIYRSCGHRKVII
IAHSMGNPLLLYFYNSIVTQEWKDKFIHSHISIAGAWGGALQIIRLLASGECVSYNMNHY
RILLPPSSLREMQRSFTSSTFLFPSYNVWSENEVLATVNDKNYTLKNVEEFFKDIGYKVG
WYQYQNTAHLLGDFQAPNIEVHCIYGYGIETPESFEWSGRWFPDYQPDTTYGDGDGTVNR
RSLEACKKWIGKNGGKKISLYAFKGGEHVDILAQEEVIELIKKIVFMHS
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggcgttaattttttcgattatgatatcagcaacaatttgcgcaacaaaagggaaacct
ttgcatccaattgtattagtacccggttatggcgggtcgcagttgaagggaaagcttact
ggaaaacctgaaactgtgcactactggtgtgctcgacaaacggatgatttcttcgatctg
tggctaaatttagagttattcttgccaacggtaatcgattgttgggtggataatatgaag
ttggtatacaatagaacaacaaacaaaacatcaagtatgccgggtgtactggtcgaggtg
cccggattccggaatacaagtaccatagaatggttggacacatcaaaagcgtcggaagga
cgctatttcactgatatcgttgaagcattgttaccattcggttatcatcgaggtaaaaat
attgtaggtgcaccatatgattggagacaagctccaaatgaactcggacactattattca
aatttgacaaaattgattgaagacatctatcgttcttgtggtcacaggaaagtgatcatt
attgcgcatagcatgggtaatccactgttgctttacttttacaacagcatcgtcacacag
gaatggaaggacaaatttattcattcgcatatttcgatagctggcgcttggggcggtgct
cttcaaattattcgtcttcttgcttcaggtgaatgtgtaagctataatatgaaccactac
agaattttactacctccaagctcactgcgtgaaatgcaacgatcattcactagttcgaca
ttcctttttccgagctacaatgtatggagtgaaaacgaagtgctggcaacagttaacgat
aaaaactacactctgaaaaatgtggaagaattctttaaagatattggctataaagttggc
tggtatcagtatcagaatacagctcatctacttggcgatttccaggcaccaaatattgag
gtgcattgtatttacgggtatggcattgaaacaccagaatctttcgagtggtccggcagg
tggtttccggattaccaaccggataccacttatggtgatggtgatggtaccgttaaccga
cgttctctagaagcatgcaagaaatggattggtaaaaacggtggcaaaaagatatctctg
tatgcgttcaaaggtggcgagcatgtggacattttggcacaggaggaagtaatcgaatta
attaaaaagattgtctttatgcatagctaa

DBGET integrated database retrieval system