KEGG   Brugia malayi (filaria): Bm1_49280Help
Entry
Bm1_49280         CDS       T01050                                 

Definition
Josephin-like protein
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
bmy  Brugia malayi (filaria)
Brite
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Bm1_49280
Peptidases [BR:bmy01002]
 Cysteine Peptidases
  Family C86
   Bm1_49280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 185 aa AA seqDB search
MNVYDSFGGTVSTGQLYHEKQQMQLCLMHTLNTLLQRNEFKKIDLDCIAENLHRSRWFNR
HRSLFGFGNYDINVLIAALETRNLILNWFDSRRSTACLNFSKIFGFIFNITSRGFIPFWT
GHHWFTVRQIGVAGFFNFDSKLNEPAPINDFVAFSDSLLAKGAQLLVVVEPQNANNYLLD
NDFSV
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtttatgattccttcggaggtacagtctcaacaggacagctatatcacgagaaa
caacaaatgcaactctgtttaatgcatacgctgaatacattgctgcagagaaatgaattt
aaaaagattgatttggattgtattgcggaaaatttacataggtcgcgctggttcaatcga
caccgttcattgttcggttttggtaattatgacatcaatgtactgatcgcggcattggaa
acacgaaatctaatattgaattggtttgattcgaggcgttccactgcttgcttgaatttt
tcgaaaattttcggtttcatattcaatatcacatcacgtggctttataccgttttggaca
gggcatcactggtttactgtacggcaaataggtgttgctggatttttcaatttcgattca
aaactgaacgaaccagcaccaattaatgacttcgttgcattttcagattcgttattagca
aagggagctcagttattagttgtcgttgaacctcaaaatgctaacaattatttgctcgat
aatgatttttcggtttaa

DBGET integrated database retrieval system