KEGG   Brugia malayi (filaria): Bm1_50100Help
Entry
Bm1_50100         CDS       T01050                                 

Definition
EST embl|AI107989|AI107989 comes from the 3' UTR, putative
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
bmy  Brugia malayi (filaria)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:bmy04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:bmy04150]
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:bmy04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 609 aa AA seqDB search
MSKQPILLLNIVCVLEWEVAFLAFSQRKAKQRSQVDEEICVRRRKVEEVRWKMSLSSDIS
KQPQIKIGHYVLNQTLGVGTFGKVKVGTHEGTGYKVAVKILNRQKIKTLDVVGKIRREIQ
NLSLFRHPHIIRLYQVISTPTDIFMIMEYVAGGELFDYIVKHGRLKTPEARRFFQQIISG
VDYCHRHMVVHRDLKPENLLLDDKNNVKIADFGLSNIMTDGDFLRTSCGSPNYAAPEVIS
GKLYAGPEVDVWSCGVILYALLCGTLPFDDEHVPSLFRKIKAGIFPIPDHLEKQVVNLLL
HMLQVDPMKRATIKDVIQHDWFQKDLPAYLFPPINESEASIVDIEAVKEVTRRYGVLEED
VTNALLGDDPHHHLSIAYNLIVDNKRIADETAKLSIEEFYQVTPIGKFQTADMFHRHPER
ISGSNKITPYLENIGGSGDSMSNSQHRSQSSSNVAASQKSPHVRRAKWHLGIRSQSRPED
IMYEVFKAMKSLGFEWKIFNPYHVVVRKKPECSTHEPPKMSLQLYQVDQKSYLLDFKSLV
DEDTGSASSSRHASVSMPVKPSLRTGRAQSLPVPMEVDHSPLPSPVVIKQSQTMQFFEMC
ASLIGTLAR
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcaaccaatcctgctgctgaacattgtttgtgtcttagaatgggaggtagcg
tttttggcatttagccagcggaaggccaaacaacgcagtcaggtagatgaagagatttgt
gttcggaggcggaaagtggaagaagtgagatggaagatgtcgctatccagtgacatttca
aaacaaccacagatcaagattggtcactatgtgttaaatcagacacttggtgttggcact
tttgggaaagtcaaggtaggaactcatgaaggcacgggttacaaagtggctgtgaaaatt
ctgaatcgacaaaagattaaaacattggatgttgttggcaaaatacgtcgtgaaatccaa
aatttgtcgctttttcgacatccacatatcattcgtttgtatcaagtaataagcacaccc
acagatatttttatgataatggaatatgttgcgggtggtgaacttttcgattatatcgtc
aaacatggaagactaaagactccagaagcacgtcgttttttccagcagataatttcgggt
gtggattactgtcatcgtcacatggttgtacatagggatttaaagccagagaacttactt
ttggatgataaaaataatgtaaagatagcagattttggtttatcgaacataatgacagat
ggggattttttgcgaacaagttgcggcagtccgaattacgcagcacctgaagtaatttca
gggaaattatacgcaggtcccgaagtagacgtgtggtcttgtggtgttatcttatatgct
cttctctgtggtactttaccttttgatgatgaacatgtgccatccttgtttaggaaaatt
aaagctggcatatttccaattcctgatcatttggagaagcaagtggtcaatttgttatta
catatgctgcaagttgatccaatgaaaagagctacaattaaagatgttatacagcacgac
tggtttcaaaaagatctgccagcttatttgtttccaccgatcaatgaaagtgaggcttct
attgtcgatatagaagcagtaaaggaggtcactaggcgatatggtgtactggaagaggat
gtaacgaatgccctgttgggtgatgatccacaccatcatttgagtattgcttataacctg
attgttgacaacaagcgtattgccgatgaaactgcaaagctatcaattgaggaattttat
caagtcacgccaatagggaaattccaaacggcggatatgtttcacagacatccagaacga
atatcaggatcaaataaaattactccatatttggagaatattggtggtagtggtgattcg
atgtccaacagtcaacataggtcgcagtcgtcttctaatgtagcagcttctcagaaatct
cctcatgtaagacgagctaaatggcatcttggaataagaagtcagagtcgaccagaagac
ataatgtatgaggtgtttaaagcgatgaaatcgcttggtttcgagtggaagatatttaat
ccttatcatgttgttgtccgaaagaaacctgaatgctcaactcatgagcctcccaagatg
agccttcaactgtaccaagtggaccagaaaagctacctccttgatttcaaaagccttgtt
gatgaagacacaggcagtgcaagttcttcgcgtcatgcatcagtttcaatgcctgtgaag
ccttcattaagaactggccgtgctcagtcattgccagttccaatggaagttgatcattca
cctctcccttcaccagtagtcattaagcagtcacaaacgatgcagttctttgaaatgtgc
gcttcattaattggtacgctagcgcgttga

DBGET integrated database retrieval system