KEGG   Brugia malayi (filaria): Bm1_50100Help
Entry
Bm1_50100         CDS       T01050                                 

Definition
EST embl|AI107989|AI107989 comes from the 3' UTR, putative
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
bmy  Brugia malayi (filaria)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Bm1_50100
   04150 mTOR signaling pathway
    Bm1_50100
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    Bm1_50100
Enzymes [BR:bmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Bm1_50100
Protein kinases [BR:bmy01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   Bm1_50100
Mitochondrial biogenesis [BR:bmy03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    Bm1_50100
  Mitophagy factors
   Other mitophagy factors
    Bm1_50100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 609 aa AA seqDB search
MSKQPILLLNIVCVLEWEVAFLAFSQRKAKQRSQVDEEICVRRRKVEEVRWKMSLSSDIS
KQPQIKIGHYVLNQTLGVGTFGKVKVGTHEGTGYKVAVKILNRQKIKTLDVVGKIRREIQ
NLSLFRHPHIIRLYQVISTPTDIFMIMEYVAGGELFDYIVKHGRLKTPEARRFFQQIISG
VDYCHRHMVVHRDLKPENLLLDDKNNVKIADFGLSNIMTDGDFLRTSCGSPNYAAPEVIS
GKLYAGPEVDVWSCGVILYALLCGTLPFDDEHVPSLFRKIKAGIFPIPDHLEKQVVNLLL
HMLQVDPMKRATIKDVIQHDWFQKDLPAYLFPPINESEASIVDIEAVKEVTRRYGVLEED
VTNALLGDDPHHHLSIAYNLIVDNKRIADETAKLSIEEFYQVTPIGKFQTADMFHRHPER
ISGSNKITPYLENIGGSGDSMSNSQHRSQSSSNVAASQKSPHVRRAKWHLGIRSQSRPED
IMYEVFKAMKSLGFEWKIFNPYHVVVRKKPECSTHEPPKMSLQLYQVDQKSYLLDFKSLV
DEDTGSASSSRHASVSMPVKPSLRTGRAQSLPVPMEVDHSPLPSPVVIKQSQTMQFFEMC
ASLIGTLAR
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcaaccaatcctgctgctgaacattgtttgtgtcttagaatgggaggtagcg
tttttggcatttagccagcggaaggccaaacaacgcagtcaggtagatgaagagatttgt
gttcggaggcggaaagtggaagaagtgagatggaagatgtcgctatccagtgacatttca
aaacaaccacagatcaagattggtcactatgtgttaaatcagacacttggtgttggcact
tttgggaaagtcaaggtaggaactcatgaaggcacgggttacaaagtggctgtgaaaatt
ctgaatcgacaaaagattaaaacattggatgttgttggcaaaatacgtcgtgaaatccaa
aatttgtcgctttttcgacatccacatatcattcgtttgtatcaagtaataagcacaccc
acagatatttttatgataatggaatatgttgcgggtggtgaacttttcgattatatcgtc
aaacatggaagactaaagactccagaagcacgtcgttttttccagcagataatttcgggt
gtggattactgtcatcgtcacatggttgtacatagggatttaaagccagagaacttactt
ttggatgataaaaataatgtaaagatagcagattttggtttatcgaacataatgacagat
ggggattttttgcgaacaagttgcggcagtccgaattacgcagcacctgaagtaatttca
gggaaattatacgcaggtcccgaagtagacgtgtggtcttgtggtgttatcttatatgct
cttctctgtggtactttaccttttgatgatgaacatgtgccatccttgtttaggaaaatt
aaagctggcatatttccaattcctgatcatttggagaagcaagtggtcaatttgttatta
catatgctgcaagttgatccaatgaaaagagctacaattaaagatgttatacagcacgac
tggtttcaaaaagatctgccagcttatttgtttccaccgatcaatgaaagtgaggcttct
attgtcgatatagaagcagtaaaggaggtcactaggcgatatggtgtactggaagaggat
gtaacgaatgccctgttgggtgatgatccacaccatcatttgagtattgcttataacctg
attgttgacaacaagcgtattgccgatgaaactgcaaagctatcaattgaggaattttat
caagtcacgccaatagggaaattccaaacggcggatatgtttcacagacatccagaacga
atatcaggatcaaataaaattactccatatttggagaatattggtggtagtggtgattcg
atgtccaacagtcaacataggtcgcagtcgtcttctaatgtagcagcttctcagaaatct
cctcatgtaagacgagctaaatggcatcttggaataagaagtcagagtcgaccagaagac
ataatgtatgaggtgtttaaagcgatgaaatcgcttggtttcgagtggaagatatttaat
ccttatcatgttgttgtccgaaagaaacctgaatgctcaactcatgagcctcccaagatg
agccttcaactgtaccaagtggaccagaaaagctacctccttgatttcaaaagccttgtt
gatgaagacacaggcagtgcaagttcttcgcgtcatgcatcagtttcaatgcctgtgaag
ccttcattaagaactggccgtgctcagtcattgccagttccaatggaagttgatcattca
cctctcccttcaccagtagtcattaagcagtcacaaacgatgcagttctttgaaatgtgc
gcttcattaattggtacgctagcgcgttga

DBGET integrated database retrieval system