KEGG   Brugia malayi (filaria): Bm1_50240Help
Entry
Bm1_50240         CDS       T01050                                 

Definition
Glycosyl hydrolase family 20, catalytic domain containing protein
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
bmy  Brugia malayi (filaria)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Bm1_50240
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Bm1_50240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 620 aa AA seqDB search
MSIISRSRWLRCRIWRFFTLRTFLIFIFCCIILEITLGLPSYKQEDDVHTEYPRDFDSKE
VIHSSFQTVKDLQKLKWNETSVQELAEKKDDRKSKLETVAPFKQSLTSLHSVRIQKQDEA
QNSTKASYDESFYANRIIHFDLKGAAPKISYLKEVLRLIKANGATGILLEWEDTFPFSGI
LAENRNSDAYTVEEVRDFLETAKSLKLDVIPLVPTFGHLEWILKVEKFRQYRQNDMFPQV
ICLADDDGVSVILDAIRQVVQFHQPFGITYFHIGADEAFQFGECLKDRRWLKENKNKGKD
NLAAMHLAKIANYIKTLIPNVRVLAWYDMIKLFESSLIEFYHLDQLLEVVVWDYSETLQQ
QNEFTWNSLAAKFPIVWGSSAYKGANGPLSAFLDLKHYFRNNKSWITHRKTYGTLFRTFR
GLIITGWQRYDHFAVLCELLPVALPSVVLNLLVAKAGDKLSTQSIIKSVTAALNCTSRIS
LEYMHSFDSCDFPGVELFSVIHSLRNHIKVIKSEVFESHQVKGWLNRFNVHHGYTQLWYL
LQMKSIIEMHISDMLNLTKMIQSLMQPIFRKNTIDEWLYEYTDPIIEQLRELLQHISELK
MRRTFTVRNFDIKRKEMQAS
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcatctcacgatctcggtggctcagatgtagaatttggaggttctttacactc
cgaacattcttgatctttatattttgttgtattattcttgaaattactctcggtcttccc
agttataagcaggaagatgatgtacacacggaatatcctcgagattttgatagcaaagaa
gtaatacacagctcatttcaaacggtaaaggatttgcagaaactaaaatggaatgaaaca
tctgtccaggaactggctgaaaaaaaggatgaccggaagtctaaactggaaacggtagca
ccgtttaagcagtcattaacatcactacattcagtgagaatacaaaagcaggatgaagcg
caaaatagcactaaagcttcttacgatgaatcattttatgcaaataggattattcatttt
gatttgaaaggtgctgcaccaaaaatatcatatttgaaggaagtattaaggcttataaaa
gcgaatggcgctactggaattttgctagaatgggaagatacatttccattcagtggtatc
ttagcagagaatcgtaatagtgatgcttacacggtggaagaagttcgtgattttttggaa
acagccaaatcactcaagcttgatgttataccgcttgtgccaacttttggacatttagaa
tggattcttaaagttgaaaaatttaggcaataccgacaaaacgacatgttcccacaggtc
atctgtttagcagatgatgatggtgtttcagtaattttggacgctatacggcaggttgtc
cagtttcatcaaccattcggaataacgtattttcacattggtgctgacgaagctttccag
ttcggtgaatgtttgaaagatcgtcgatggcttaaagaaaataaaaataagggaaaagat
aatcttgcagcaatgcatttagcaaaaattgcaaattacatcaaaactctaattccaaat
gtcagagtgttagcatggtacgatatgattaaattatttgaatcttcattgatcgagttc
tatcatctggatcaactcttagaagtggtggtttgggattattccgaaacgttgcagcag
caaaatgagttcacatggaattctctggctgcaaaattcccaatagtttggggctcatcc
gcttacaaaggagccaatggaccattatcagcgtttttggatttgaagcattattttcga
aacaataagtcatggattacacatcggaaaacatatggcacattatttcgtacattccga
ggtttaatcataaccggttggcaacgatatgatcactttgcagtattatgcgaacttctt
ccggtagcrcttccatcagttgtgttaaatcttctagtagcaaaagcaggtgataaactt
tctactcaatcgataattaaatctgtcactgctgcactgaattgtacatcaagaatctca
ttagaatacatgcattcatttgattcctgcgacttcccaggtgttgaattattcagtgtt
attcattccttacgtaatcatatcaaagtgatcaaaagtgaagtttttgagagtcaccag
gtaaaaggttggctcaatcgattcaatgtacaccatggttacacccagttgtggtatttg
ctgcaaatgaaaagcatcattgaaatgcatattagtgacatgcttaatttgaccaaaatg
atccagtctttgatgcagccaattttccggaaaaatacaatcgatgaatggctatatgaa
tatactgatccgattatagagcaattgagggaactattgcaacacatttctgaacttaaa
atgcgacgaacattcactgttagaaattttgacatcaaaaggaaagagatgcaagcatcg
taa

DBGET integrated database retrieval system