KEGG   Brugia malayi (filaria): Bm1_50405Help
Entry
Bm1_50405         CDS       T01050                                 

Definition
L-asparaginase
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
bmy  Brugia malayi (filaria)
Brite
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Bm1_50405
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     Bm1_50405
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     Bm1_50405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 592 aa AA seqDB search
MSTIHGEEARVLVLYTGGTIGMKCIDGVYRPEANYLLRAMRNMPLLNDCDYVSTNYADAK
TKPYCLPSLQHSKKRLVYWVVEYDPLLDSSDMTFDDWIKIGKDIQEAYDQYVGFVILHGT
DTLAYTACALSFMLENVGKPVVITGAQIPVFEVRSDGRENLIGALIMAAYYDIPEVTVYF
NNKLFRGNRTIKVDNSSLEAFESPNMLPIAHMDIDIKVNYDSIFRSPSVAPFVIHDRLCR
NVGLLRIFPSISIENVRASLQPPTEGVVLQTFGAGNMPSHRTDIIDELKKAIDRGCLIIN
CSQCVRGQVDVQYLTGKILYDIGVIPGSDMTTEAALTKLSYVLSKDCWGLSKKKAMMVKN
IRGELTVTQPKPLRDLEIVSQIARFLHLNTSHELEFLRHAILPQLLCHAADSGNVELLRA
LRENGANLSAIDYNGRNALHIAASAGHVDAVKYLLTQGVSFQLRDQRDENALVAAVRTKN
KVCIETLRSAGAVLSISPFQLGVELCLCASCGDIETLNSWLAAGADINQQDYGGRTALHI
AVESRNKQLIYYLLGRGADPDKSDYFDLTPLGHAKKLNLQDLVIKMKKREVQ
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaatacatggtgaagaggcacgtgttttggtgttgtatacaggtgggacgatt
gggatgaaatgcattgatggagtatatcgtccggaagctaattatcttctgcgtgctatg
cgtaatatgccactattaaacgattgtgattatgtgtccacaaattatgctgatgccaaa
acaaaaccgtaytgtttgccatcactacagcattcgaaaaaacgtcttgtttattgggtg
gtcgagtatgayccacttttggattcatcagacatgacttttgatgactggattaaaatt
ggtaaggacattcaagaagcttatgatcaatatgtgggttttgttatattgcatggtact
gacacgttggcatataccgcatgtgctctatcatttatgcttgagaatgttggaaaaccc
gttgttataacgggtgctcaaatcccagtgtttgaggttcgatctgatggtcgggaaaat
ttgattggagcactgattatggcagcctattatgatattcctgaagttactgtatatttt
aataataaactcttccggggaaatcgtacaataaaagtagataacagctcgttagaagca
tttgaaagcccgaatatgctcccaattgctcacatggatattgatataaaagttaattat
gattcaatattccgctctccctcagtagctccttttgtaatacacgatcgattatgtcga
aatgttggattgttacgaatttttccatcaatatccatagaaaatgtgagagcatcattg
caaccacccaccgaaggtgttgtcctgcagacatttggtgctggtaatatgccatcccat
agaacagatataatagatgaattgaaaaaagctattgatcgaggatgtcttattatcaat
tgttcacagtgtgtccggggacaagtagatgttcagtatttaacaggaaaaattctttat
gatataggagtcattcctggttcagatatgactacggaagcagcattaacaaaattatca
tatgtactaagcaaagattgttggggactttcaaagaagaaagcaatgatggtcaaaaat
atcagaggcgaattaactgttacacaaccaaaaccactcagagaccttgaaatagtttca
cagatagcaaggttcttgcatctaaatacttctcacgaactggagtttctacgccacgct
attcttccacaattactgtgtcatgctgctgatagtggtaatgttgagctgcttcgcgca
cttcgtgaaaatggagctaatctttcggctatcgattacaatggacgtaatgctctacat
atagcagctagtgcaggacatgtggacgctgtaaagtacctgttgactcaaggcgttagt
ttccaacttagggatcagcgagacgagaatgcccttgtagctgcagtaagaacaaaaaac
aaggtttgcattgagactttgcggtctgcaggagcagtactttccataagtccattccag
ctaggtgttgaactatgcctatgtgccagttgtggtgacatagagacactaaattcttgg
cttgctgctggagctgatataaatcaacaagactacggtggtaggactgctctgcatatt
gcggtagaatcaagaaataagcaactaatatattatctgctcggtcgaggtgctgatcca
gacaaaagtgactattttgatttaacaccactcgggcatgctaaaaaacttaatttgcaa
gatctggtcattaagatgaaaaagcgcgaagttcagtaa

DBGET integrated database retrieval system