KEGG   Brugia malayi (filaria): Bm1_50775Help
Entry
Bm1_50775         CDS       T01050                                 

Definition
Plasmid Maintenance Protein containing protein
Orthology
K03847  
alpha-1,6-mannosyltransferase [EC:2.4.1.260]
Organism
bmy  Brugia malayi (filaria)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    Bm1_50775
Enzymes [BR:bmy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.260  dolichyl-P-Man:Man7GlcNAc2-PP-dolichol alpha-1,6-mannosyltransferase
     Bm1_50775
Glycosyltransferases [BR:bmy01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   Bm1_50775
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 432 aa AA seqDB search
MGKRKRLSEWFLIGYDHHEFPGVVPRTFMGAVAVSVPLFPIIKWNYIAKHWILYGMRLVL
GLAVLFAFGHFARQIDKNFGKLSGDFLRLIVATQFHFMFYCSRPLPNTFALLGVLWTYQK
ILDGQWLCAARIATVFTLLFRCELILFYGCVFIWPVLTRQLSLFGWNGAVVHCLSTAMLT
LGISVPLDSFLWRRWLWPEGEVLWFNVILNRSHEYGIQPYFWYFYSAIPRAMIASTLLIP
LGALIVDSGFIQIVLWICILFFIWINRWKSMFGMLLAVGVVLHLIVNVIGTSIFLLASSR
NYPGGEALTSLQYLRHFSRNKPLSVYIDNYAAQTGVSRFLQWYDAWEYNKTENLEPSQLA
RFDYLLIGSYTEPDIVNFAARKFFPTHRVLYDIEAFQGIDFGKMQWFPYYWPIIKLNAQL
VVLEKLHYSDTF
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaaggaaacgactctcagaatggtttctgataggatatgatcatcatgaattt
cccggagttgtgccacgtacttttatgggcgccgtggcagttagtgttccactttttcct
ataatcaaatggaattatattgcaaaacactggattttgtatggcatgaggcttgtgctt
ggtctagcagttctattcgcatttggtcattttgctcgacagattgacaaaaactttggc
aaattgtcaggcgattttctaagattaattgtagcaacacagttccatttcatgttctac
tgttccaggcctcttccaaatacatttgccttacttggagtactttggacctaccagaaa
attttggatggacagtggttatgtgcagcacgaattgctacggtttttacattactattt
cgatgtgaactgattttgttttatggctgtgttttcatatggcctgttttaacacgccaa
ctgtccctgttcggttggaatggtgctgttgttcattgcttgtcgactgctatgcttact
ctgggcatatctgtaccactggattctttcttgtggcgacgatggctatggcctgaaggc
gaagtgttgtggttcaatgtgatattgaatagaagtcacgaatatggtattcaaccttat
ttctggtatttttattctgcgattccacgtgcaatgatagcctcaactcttcttatacct
ttaggtgcattaattgtcgattctggttttatacaaattgtgttatggatatgtattttg
ttttttatttggatcaatcgttggaaatcaatgtttggtatgttattggccgttggagta
gtgctacatttaatcgtaaatgttatcggcacttccatcttcttacttgctagttctaga
aattatcctggtggtgaagcactcacttctctccagtatttgcgacatttcagtcgaaat
aaaccactttccgtctatatcgacaattatgctgctcagactggtgtcagtagattcttg
cagtggtatgatgcttgggagtataataaaaccgaaaatttggaaccatctcaacttgca
cgattcgattatctgttgattggttcctacacggaacctgatatcgtcaactttgccgca
cgaaaattctttcccactcatcgtgttttatatgatattgaagcattccaaggaattgat
ttcggaaagatgcagtggttcccatattattggcctatcataaagctgaatgcgcagtta
gtggtgttggaaaaattgcattactctgatacattttga

  All links  
No link information was found.   
DBGET integrated database retrieval system