KEGG   Brugia malayi (filaria): Bm1_50775Help
Entry
Bm1_50775         CDS       T01050                                 

Definition
Plasmid Maintenance Protein containing protein
Orthology
K03847  
alpha-1,6-mannosyltransferase [EC:2.4.1.260]
Organism
bmy  Brugia malayi (filaria)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:bmy00510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 432 aa AA seqDB search
MGKRKRLSEWFLIGYDHHEFPGVVPRTFMGAVAVSVPLFPIIKWNYIAKHWILYGMRLVL
GLAVLFAFGHFARQIDKNFGKLSGDFLRLIVATQFHFMFYCSRPLPNTFALLGVLWTYQK
ILDGQWLCAARIATVFTLLFRCELILFYGCVFIWPVLTRQLSLFGWNGAVVHCLSTAMLT
LGISVPLDSFLWRRWLWPEGEVLWFNVILNRSHEYGIQPYFWYFYSAIPRAMIASTLLIP
LGALIVDSGFIQIVLWICILFFIWINRWKSMFGMLLAVGVVLHLIVNVIGTSIFLLASSR
NYPGGEALTSLQYLRHFSRNKPLSVYIDNYAAQTGVSRFLQWYDAWEYNKTENLEPSQLA
RFDYLLIGSYTEPDIVNFAARKFFPTHRVLYDIEAFQGIDFGKMQWFPYYWPIIKLNAQL
VVLEKLHYSDTF
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaaggaaacgactctcagaatggtttctgataggatatgatcatcatgaattt
cccggagttgtgccacgtacttttatgggcgccgtggcagttagtgttccactttttcct
ataatcaaatggaattatattgcaaaacactggattttgtatggcatgaggcttgtgctt
ggtctagcagttctattcgcatttggtcattttgctcgacagattgacaaaaactttggc
aaattgtcaggcgattttctaagattaattgtagcaacacagttccatttcatgttctac
tgttccaggcctcttccaaatacatttgccttacttggagtactttggacctaccagaaa
attttggatggacagtggttatgtgcagcacgaattgctacggtttttacattactattt
cgatgtgaactgattttgttttatggctgtgttttcatatggcctgttttaacacgccaa
ctgtccctgttcggttggaatggtgctgttgttcattgcttgtcgactgctatgcttact
ctgggcatatctgtaccactggattctttcttgtggcgacgatggctatggcctgaaggc
gaagtgttgtggttcaatgtgatattgaatagaagtcacgaatatggtattcaaccttat
ttctggtatttttattctgcgattccacgtgcaatgatagcctcaactcttcttatacct
ttaggtgcattaattgtcgattctggttttatacaaattgtgttatggatatgtattttg
ttttttatttggatcaatcgttggaaatcaatgtttggtatgttattggccgttggagta
gtgctacatttaatcgtaaatgttatcggcacttccatcttcttacttgctagttctaga
aattatcctggtggtgaagcactcacttctctccagtatttgcgacatttcagtcgaaat
aaaccactttccgtctatatcgacaattatgctgctcagactggtgtcagtagattcttg
cagtggtatgatgcttgggagtataataaaaccgaaaatttggaaccatctcaacttgca
cgattcgattatctgttgattggttcctacacggaacctgatatcgtcaactttgccgca
cgaaaattctttcccactcatcgtgttttatatgatattgaagcattccaaggaattgat
ttcggaaagatgcagtggttcccatattattggcctatcataaagctgaatgcgcagtta
gtggtgttggaaaaattgcattactctgatacattttga

DBGET integrated database retrieval system