KEGG   Brugia malayi (filaria): Bm1_50880Help
Entry
Bm1_50880         CDS       T01050                                 

Definition
calcineurin B
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
bmy  Brugia malayi (filaria)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    Bm1_50880
   04310 Wnt signaling pathway
    Bm1_50880
   04020 Calcium signaling pathway
    Bm1_50880
Protein phosphatases and associated proteins [BR:bmy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Bm1_50880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 185 aa AA seqDB search
MASCFREMSHPYQWKCAAIFFVTLIALAVDAYELRRLARRFKKLDLDGSGSLSVDEFMSL
PELQQNPLVQRVIDIFDEDGDGEVDFREFIQGISQFSVKGDKTVKLKFAFRIYDMDRDGY
ISNGELFQVLKMMVGNNLKDNQLQQIVDKTILFHDKDGDGKISFDEFCDVVEHTEVHKKM
VLENI
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgtgtttcagggaaatgagtcatccttaccaatggaaatgtgcagcaattttt
ttcgtaaccttaattgcacttgcagttgatgcatatgagttgcggcgcttagcacgacgc
ttcaaaaaattagatttggatggttcgggaagtttgagtgttgacgaatttatgtcatta
ccagaacttcaacaaaatccattggtccaaagagttattgatatattcgatgaagatggt
gatggggaagtcgatttcagagaattcattcagggaatatcacaatttagtgtcaaagga
gacaaaacagtaaagctcaagtttgcatttcgtatatatgatatggatcgggatggatat
atctcgaatggagagctttttcaggttttaaaaatgatggtgggaaacaatttaaaagat
aaccaactacaacaaatagttgacaaaacaatactatttcatgataaagatggcgatggt
aaaatatcgttcgatgagttctgcgatgttgtggagcataccgaagttcacaagaaaatg
gtactagaaaatatttga

DBGET integrated database retrieval system