KEGG   Brugia malayi (filaria): Bm1_50880Help
Entry
Bm1_50880         CDS       T01050                                 

Definition
calcineurin B
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
bmy  Brugia malayi (filaria)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Wnt signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:bmy04010]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:bmy04310]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:bmy04020]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 185 aa AA seqDB search
MASCFREMSHPYQWKCAAIFFVTLIALAVDAYELRRLARRFKKLDLDGSGSLSVDEFMSL
PELQQNPLVQRVIDIFDEDGDGEVDFREFIQGISQFSVKGDKTVKLKFAFRIYDMDRDGY
ISNGELFQVLKMMVGNNLKDNQLQQIVDKTILFHDKDGDGKISFDEFCDVVEHTEVHKKM
VLENI
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgtgtttcagggaaatgagtcatccttaccaatggaaatgtgcagcaattttt
ttcgtaaccttaattgcacttgcagttgatgcatatgagttgcggcgcttagcacgacgc
ttcaaaaaattagatttggatggttcgggaagtttgagtgttgacgaatttatgtcatta
ccagaacttcaacaaaatccattggtccaaagagttattgatatattcgatgaagatggt
gatggggaagtcgatttcagagaattcattcagggaatatcacaatttagtgtcaaagga
gacaaaacagtaaagctcaagtttgcatttcgtatatatgatatggatcgggatggatat
atctcgaatggagagctttttcaggttttaaaaatgatggtgggaaacaatttaaaagat
aaccaactacaacaaatagttgacaaaacaatactatttcatgataaagatggcgatggt
aaaatatcgttcgatgagttctgcgatgttgtggagcataccgaagttcacaagaaaatg
gtactagaaaatatttga

DBGET integrated database retrieval system