KEGG   Brugia malayi (filaria): Bm1_50975Help
Entry
Bm1_50975         CDS       T01050                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bmy  Brugia malayi (filaria)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bmy00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 201 aa AA seqDB search
MQMQQIQCNNMVQHSSTKQENLRQSYETIIRHCADDCKRPGLIKTPERAARAMLFFTKGY
EDNLDDLINGAVFNEDHDDMVIVKDIEIFSLCEHHLVPFIGKAHIGYIPNKKILGLSKIA
RIVEMFSRRLQVQERLTKQIAAALIKAVQPLGVGVVIEASHMCMIMRGIQKINAVTITSC
MMDVFRKDSKTREEFLKLIKT
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgcagcagatccagtgcaataatatggtgcaacattcatcgacaaagcaggaa
aatttacgtcagtcctatgaaactattatccgacattgtgcagatgactgcaaacgtcca
ggattaattaaaactcccgagagagctgcccgagctatgcttttcttcaccaaaggctat
gaagacaacttagatgatttgattaacggagcagtgtttaatgaagatcacgatgacatg
gtgatcgttaaggatatcgagattttttccttgtgtgaacatcacctagtacctttcatt
ggtaaagcacatatcggttacataccgaacaaaaaaattttgggtctcagcaagatcgcc
cgtattgttgaaatgtttagccgacgtttacaagtgcaagaacgattaacaaagcaaata
gcagcagcattaatcaaagccgtgcaaccacttggtgttggtgttgtcatagaagctagt
cacatgtgcatgattatgcgcggtatccagaaaatcaacgccgttactatcaccagctgt
atgatggatgttttccgaaaggattctaagacgagggaagaattcttaaaattaatcaaa
acttaa

DBGET integrated database retrieval system