KEGG   Brugia malayi (filaria): Bm1_51510Help
Entry
Bm1_51510         CDS       T01050                                 

Definition
translation initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
bmy  Brugia malayi (filaria)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Bm1_51510
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Bm1_51510
Translation factors [BR:bmy03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Bm1_51510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 245 aa AA seqDB search
MPISKSEITKQESTNDKENPLETTEEAVQSNDNEDETSHAERSEFENLSAATPESLTRHP
LQCRWALWYLKADRNKDWEDCLKQVAVFDTVEDFWALYNHIQTASGLNWGSDYYLFKEGI
KPMWEDENNVKGGRWLVVVDKQKRAQLLDHYWLELLMAIIGEQFEEHGEHICGAVVNVRQ
KGDKVSLWTRDSLKDDVNLRIGQILKAKLEIPDSEPIRYEVHKDSSVRTGSMVKPRIVIP
MKETR
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgcctatatcgaaatcggaaattactaagcaagagtcaaccaacgacaaggagaatccg
ttggaaacaaccgaagaagctgtccagtctaacgataatgaagatgaaacaagtcatgct
gagcggtctgagtttgaaaatctttctgcagcaactccagaatcacttacacgtcatccg
ttgcagtgccgatgggctctgtggtatttaaaagctgatcgaaacaaagactgggaggat
tgtttgaaacaagtagccgtctttgacactgttgaagatttttgggccttgtataatcac
atccagactgcttcgggtcttaattggggaagcgactactatttatttaaagagggtatt
aaaccgatgtgggaggacgaaaataatgtgaagggtggtcgttggcttgttgttgttgac
aaacaaaaacgagcgcaattattggaccattactggcttgagctactgatggcaattatt
ggggaacagtttgaagaacatggcgaacatatttgcggtgcggttgtaaatgttcgacag
aagggcgataaggtttcactatggacacgtgactcactgaaggatgatgtgaatttgcgt
attgggcaaattttaaaagcaaaacttgaaatcccagattcggaaccgattcgttatgaa
gttcataaggactcatcggtgcgtacgggttcgatggtaaaaccccgtattgtcatccca
atgaaagaaacgaggtaa

DBGET integrated database retrieval system