KEGG   Brugia malayi (filaria): Bm1_51515Help
Entry
Bm1_51515         CDS       T01050                                 

Definition
(RefSeq) Ubiquitin carboxyl-terminal hydrolase family protein
  KO
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
bmy  Brugia malayi (filaria)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Bm1_51515
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Bm1_51515
Peptidases [BR:bmy01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Bm1_51515
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 850 aa AA seqDB search
MVLNRPTLIHLADLRFSSLEHLKSWCDVTHKQKWEQAISRLVSTKAFDHAERVFDEAKLK
MREGDEEDAYKLFTRMGIISKIIITKSDFQEFKNSPVXIKRDGRRFYYLFDQCIAYLKEL
EESLKKRYELKKAEKSYDEQDLSVLQSEETPEDKDYFMKESMVIDPRDLVRYIACKHRAL
IIDYRKDQTDVIQYANAGQLLVAQVPADAVVPGCIGSSLIRSAEIAQRAILQRMADVDVV
VLMGSGNAPNEEKDMIAGSKEQILYSALSMYNNNFRLKNLPKFLKGGFENWRLYYPMHTT
TKFAMRRKFVDIANRTEFARAVAEYKKGFGIDSLEYPQLLPMVYSKASGLSMPYSSASDS
IVHHMGQSSSYSSMLIETSDVPDESSSLGLVLPPKNELLDVRIDADTANESSAMRNSNVT
DVTVPPISRNVTRNSXSQVDVCALQSRQLPVIDRSKKPLSELSTFKEKASSEKSFSLKST
PTMFGGAKLYGARLLKTNCSEYPNCTGQVTETTVMSKNPGYTGLYNLGNTCFMNSVLQTL
FNTIPLRRIFTKNEFFKFVNRTNKMGTMGIISSVFSAMMDSVWSGLFSALRPQQFLETFA
AEVNASLADGQQHDAQEFQIYLLDALHEDTNRVMKRKTFEQNYTGANLKAEAADYNEKLR
GFACSPISDIFNCQTVSSLQCNKCKRQSVTFEELAQLSIEVPNRNSTIEDCIRNHFQDVE
LDGSCKWRCPDCESLQTATRRTFLWKLPEVLVIHLKRFTFMGDNWQKNDAYVTFNTFPLK
LQSEYFSLYAVVNHRGSLNSGHYTAVVRNQITKQWLLFDDDVVAPIDVDLICSKYAFILY
FQKDSLSQIL
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atggttctgaatcgtcccacattaattcaccttgctgatttacgtttcagtagtttggaa
catttgaaatcatggtgtgatgtaacccataagcagaagtgggagcaagcgatttcacga
ctcgtttccaccaaagcattcgaccatgcagaacgggttttcgatgaagcaaagctgaaa
atgcgggagggagatgaggaagatgcatacaagctgttcacacgaatgggcattatctca
aaaataattattaccaagagcgactttcaagaattcaaaaattcaccggtaatrataaag
cgggatggtcgacgtttttactacttgtttgaccagtgtattgcttatctgaaagaactg
gaagaaagtttaaagaaacggtatgagttgaagaaagctgagaaaagttatgatgagcag
gacttatcagttttgcagagtgaagaaacaccggaagacaaagattatttcatgaaggaa
tcgatggtaatagatccacgtgacctggtacggtatattgcttgtaaacatcgagcgctt
atcattgattatcgaaaggaccagacagatgtcatccaatatgcaaacgctgggcagtta
ttggttgcacaggttcctgccgatgctgtcgtccctggttgtattggttcttcactgatt
cgctcggctgagattgctcaaagagctattcttcagcgaatggcagatgtagatgtggtt
gtgcttatgggaagtggcaatgctccaaatgaggaaaaagatatgattgctggatcaaag
gaacaaatactctatagcgcattatcaatgtataacaataactttcggttgaaaaatcta
ccaaaatttttgaaaggtggttttgaaaattggcgtttatattatccaatgcatacaacc
acaaaatttgcgatgcgaaggaaatttgtggatattgcaaatcgtactgaattcgctaga
gcagttgctgaatataaaaaaggttttgggattgattccttagaatatcctcaattacta
ccaatggtttactctaaagcaagtggattatcaatgccttactcgagtgcttcagatagt
atcgtgcatcatatgggacaatcttcgtcttattcctcaatgttgatagaaacttcagac
gttcctgatgaatcatcatccttgggcttagtgctgccaccgaaaaatgaattgcttgat
gttaggatagatgcagatacagcaaatgaatcatcagctatgaggaattcaaacgttaca
gacgttacagttcctccaatctcccgaaatgtgactagaaattctarttcgcaggttgat
gtttgtgcacttcaatctcgtcaactccctgtaattgaccgaagcaagaaaccactttca
gagttatctacttttaaagaaaaagcctcttctgaaaagtctttttcacttaaatcgact
ccaacgatgtttggtggtgcaaaattatacggtgcaaggctactcaaaacaaactgcagt
gaatatcccaactgtaccggacaggttactgaaaccacagttatgtccaagaatcccgga
tacactggtttgtacaatttgggtaatacatgcttcatgaattccgtgttacaaactttg
ttcaatacaattccactgcgacgtattttcaccaaaaacgaatttttcaaatttgttaac
aggacaaacaaaatgggtacaatgggtataatatcgtctgtattctcggcaatgatggat
tctgtttggagtggattgttcagtgctcttcgtcctcaacaatttcttgaaacatttgct
gctgaagtgaatgcttctttggcggatggtcagcaacatgatgcacaagaatttcaaatt
tatttacttgatgcattgcatgaagatacaaatcgggtaatgaaacgcaaaacatttgag
cagaattatactggagcaaatttgaaagcagaagcagctgattataatgaaaagttaagg
ggatttgcctgttcaccgatcagtgacatttttaattgtcaaacagtatcaagtttgcaa
tgcaataagtgcaagcgacaaagcgtcactttcgaagaattggctcagttgtcaatagaa
gtaccaaatcggaattcaacaattgaagattgtatacggaatcattttcaagatgtggaa
cttgatggttcatgcaaatggcgttgccctgattgtgagtctttacagactgcaactcgt
agaacgtttctgtggaagctacctgaagttctggtcatacacttgaaacgtttcactttt
atgggagataactggcagaaaaacgatgcttacgtaacttttaacacgtttccactaaag
ctacaatctgaatatttcagcttatatgctgttgtcaaccacagagggagtttgaatagc
ggacattatacagcagtggttcgtaaccaaatcactaaacaatggttactcttcgacgat
gatgttgttgcgccgatagatgtggatttgatatgctcgaagtatgcctttatcttatat
tttcagaaagattctctgtcgcaaattttatga

DBGET integrated database retrieval system