KEGG   Brugia malayi (filaria): Bm1_51565Help
Entry
Bm1_51565         CDS       T01050                                 

Definition
Palmitoyl-protein thioesterase 1 precursor
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
bmy  Brugia malayi (filaria)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bmy01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:bmy00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:bmy04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 312 aa AA seqDB search
MVTNCVFVIXWLLSIGSATITTNSVTQFLQKILSNVEPTPIVLWHGMGDSCCNPLSLGKI
EKILKQNIPNVYIYSVMIGPNVVMDTEHGFFGNVNDQVAEVCQAIQKDAKLKNGYNSIGF
SQGAQFLRALVQRCPVPQMKNLISLGGQHQGVFGLPLCPAESYICDRVRNLLEWGAYVGF
VQNTVVQAQYWHDPLDETTYRQNSIFLADINNERNLNETYKENLLKLQNLVLVKFLNDTM
VVPRESEWFEYYLENDTSKIVPLEKSKIYTEDRLGLRELLESKRLHLLAFEGQHLQIDTS
SFVSQIINKFLK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaattgtgtttttgtcattamttggctgctttctatcggatcggcaacaatc
acaactaattctgtcacccagtttctacagaaaatcctcagcaatgtggagcctacacca
attgtactgtggcatggcatgggtgatagctgttgcaatccattaagtttgggaaaaata
gaaaaaatactaaagcagaatatccctaatgtctatatttattcagtaatgataggaccc
aacgttgtaatggatacggaacatggtttcttcggtaatgtaaatgatcaggtagcagaa
gtatgtcaagcaatacagaaagacgcaaaattgaaaaatggatacaattctattggtttt
tcacagggcgcacaatttctacgtgctctggtacaacgctgtccagttccacagatgaaa
aacttaatttcattgggcggacaacatcaaggagtatttggattaccgctatgtccagct
gaaagttatatttgtgatcgcgtgcgaaatttattggagtggggtgcttatgttggcttt
gtccagaatacggtagtccaggcgcaatattggcacgatccattagatgaaacaacctac
cgacaaaacagtatattccttgctgatatcaacaatgaaagaaacctgaatgagacatat
aaagaaaatttattgaaactacaaaatttggtgctggtgaaatttctgaatgatacaatg
gtagtaccgagagaatctgagtggttcgaatattatctcgagaatgacacatcaaaaatc
gttccactggagaaatcaaaaatttacacagaggatcgtcttggcttgcgagaattgtta
gagagcaaacggttgcacttactagcatttgaaggacaacatctacaaatcgacacttca
tcttttgtatctcagattattaataaatttttgaaataa

DBGET integrated database retrieval system