KEGG   Brugia malayi (filaria): Bm1_51565Help
Entry
Bm1_51565         CDS       T01050                                 

Definition
Palmitoyl-protein thioesterase 1 precursor
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
bmy  Brugia malayi (filaria)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Bm1_51565
  Lipid metabolism
   00062 Fatty acid elongation
    Bm1_51565
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Bm1_51565
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     Bm1_51565
Lipid biosynthesis proteins [BR:bmy01004]
 Fatty acid synthase
  Component type
   Bm1_51565
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 312 aa AA seqDB search
MVTNCVFVIXWLLSIGSATITTNSVTQFLQKILSNVEPTPIVLWHGMGDSCCNPLSLGKI
EKILKQNIPNVYIYSVMIGPNVVMDTEHGFFGNVNDQVAEVCQAIQKDAKLKNGYNSIGF
SQGAQFLRALVQRCPVPQMKNLISLGGQHQGVFGLPLCPAESYICDRVRNLLEWGAYVGF
VQNTVVQAQYWHDPLDETTYRQNSIFLADINNERNLNETYKENLLKLQNLVLVKFLNDTM
VVPRESEWFEYYLENDTSKIVPLEKSKIYTEDRLGLRELLESKRLHLLAFEGQHLQIDTS
SFVSQIINKFLK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaattgtgtttttgtcattamttggctgctttctatcggatcggcaacaatc
acaactaattctgtcacccagtttctacagaaaatcctcagcaatgtggagcctacacca
attgtactgtggcatggcatgggtgatagctgttgcaatccattaagtttgggaaaaata
gaaaaaatactaaagcagaatatccctaatgtctatatttattcagtaatgataggaccc
aacgttgtaatggatacggaacatggtttcttcggtaatgtaaatgatcaggtagcagaa
gtatgtcaagcaatacagaaagacgcaaaattgaaaaatggatacaattctattggtttt
tcacagggcgcacaatttctacgtgctctggtacaacgctgtccagttccacagatgaaa
aacttaatttcattgggcggacaacatcaaggagtatttggattaccgctatgtccagct
gaaagttatatttgtgatcgcgtgcgaaatttattggagtggggtgcttatgttggcttt
gtccagaatacggtagtccaggcgcaatattggcacgatccattagatgaaacaacctac
cgacaaaacagtatattccttgctgatatcaacaatgaaagaaacctgaatgagacatat
aaagaaaatttattgaaactacaaaatttggtgctggtgaaatttctgaatgatacaatg
gtagtaccgagagaatctgagtggttcgaatattatctcgagaatgacacatcaaaaatc
gttccactggagaaatcaaaaatttacacagaggatcgtcttggcttgcgagaattgtta
gagagcaaacggttgcacttactagcatttgaaggacaacatctacaaatcgacacttca
tcttttgtatctcagattattaataaatttttgaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system