KEGG   Brugia malayi (filaria): Bm1_52415Help
Entry
Bm1_52415         CDS       T01050                                 

Definition
proprotein convertase 2
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
bmy  Brugia malayi (filaria)
Brite
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     Bm1_52415
Peptidases [BR:bmy01002]
 Serine Peptidases
  Family S8: subtilisin family
   Bm1_52415
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 661 aa AA seqDB search
MRRWHKWQRCSTYSILLFIICTSVNAVEIYTNHFYVHIRQPGIENAHLIAKRHGFINHGS
VLGSTVDWHFVQPALSHARTKRSYTHYKKLSDDRDVVHVEQLTGFKRVKRGYRALEERLQ
EQLDFTAAQSPTDPLYPYQWYLNNVGQANGKPRLDLNVEKAWVLGITGKNITTAIMDDGV
DYMHPDLANNFNARASYDFSSNDPFPYPRYTDDWFNSHGTRCAGEIAAARDNGICGVGVA
YDSKVAGIRMLDQPYMTDLIEANSMSHEPNLIHIYSASWGPTDDGKTVDGPRNATMRAIV
KGVNEGRNGLGSIFVWASGDGGEEDDCNCDGYAASMWTISINSAINSGENAHYDESCSST
LASTFSNGGRNPETGVATTDLYSRCTRSHSGTSAAAPEAAGVFALALEANPLLTWRDLQH
LTVLTSTRNSLFDGRCRDLPDLGIEEDDGNNINGINNCTHFEWKMNGVGLEFNHLFGFGV
LDAAEMVMLAMVWKTVPSRFHCEAGTIATSREIPSTGNLVLELITDACLGTPTEVNYLEH
VQAVVSLNSSRRGDTTLYLVSPSGTQTMILSRRPKDNDNKNGFTNWPFMTTHTWGENPRG
KWRLIVRFQGSYKNHGMVKKFTLMLHGTKDPPYTGIEPLQGHVNSKLKVVQKAHKRASFR
R
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgagaagatggcataagtggcaacggtgtagcacatacagtattctgctgtttataatc
tgtacatctgtcaatgcggttgaaatatatactaatcatttttatgtccatatcagacaa
ccaggcattgagaatgcccatttaatagctaaacgacatggcttcattaatcatggatca
gttcttggctccaccgttgattggcatttcgtccaaccagccctatcacatgcacgaaca
aagcgttcctacactcattataaaaaattaagtgacgatcgtgatgtggtgcacgtggaa
cagttaacgggtttcaaacgtgtgaagagaggatatagagctctggaggaacggttgcag
gagcagctcgattttactgcggcgcaatcaccaactgacccgctctacccatatcagtgg
tacttgaataatgttggacaagcgaacggtaaaccacgactagatttaaatgtcgaaaaa
gcttgggtacttggtatcactggtaaaaatataacaacggctatcatggatgatggtgtt
gattatatgcatccggatctggcgaataattttaatgcaagggctagctacgattttagt
tctaatgacccattcccctatccaaggtacaccgatgactggttcaactcacacggaaca
cgctgtgccggtgaaatagccgcagcacgtgataatggtatttgcggcgtcggtgttgct
tatgatagtaaagtagctggtattcggatgctggatcaaccttacatgacagatctcatc
gaggccaattcaatgagccatgagccaaatttgattcatatttattcggcaagctgggga
cctactgatgatgggaaaacggtagatggaccacgtaatgcaacaatgcgtgctatcgtc
aaaggtgttaatgagggacgtaatggtttgggatcaatttttgtatgggcaagtggggat
ggcggtgaggaagacgactgcaactgtgatggttatgctgcttccatgtggacaatatct
attaattccgcaattaacagtggtgaaaatgcgcactatgacgaaagttgctcttctaca
ttggcttcaacattttcgaacggaggacgaaatccagaaactggggtagcaacaacggat
ttgtatagccgttgcacgcgatcgcatagtggaacatcggcagcagcaccggaagcagct
ggtgtttttgcgctggcactagaagcaaatccattacttacttggcgtgatttacaacat
ctaacagtactgacatcaacacgaaattcattatttgatgggcgatgcagagacttgcca
gatcttggcattgaagaggacgacgggaacaatataaatggtatcaataactgcactcat
tttgaatggaaaatgaatggcgttggcttggaatttaatcatttgttcggttttggtgta
ttggatgcagctgaaatggttatgttggcgatggtttggaagactgtgccttcaagattc
cactgcgaagcggggactattgctacatcgcgcgaaattccctcgaccggaaatcttgta
ctggaattgattactgatgcatgcttgggaactccgacagaagttaattatttggaacac
gtacaagccgttgtctctttaaatagcagccgacgtggtgacactactctttatctagta
tctccatctggtacacaaacaatgattttgtctcggcgtccaaaagataatgataacaaa
aatggattcacgaattggccctttatgaccacacatacttggggtgaaaatccacgcggc
aaatggcgcttgattgtccgattccaaggcagctacaaaaatcacggtatggtgaagaaa
tttacccttatgcttcatggtaccaaagatccgccatatactggtattgaacctcttcaa
ggacatgtaaacagtaaactgaaagtggtacagaaggcacataaacgtgcttcatttcgt
cgttga

DBGET integrated database retrieval system