KEGG   Brugia malayi (filaria): Bm1_52540Help
Entry
Bm1_52540         CDS       T01050                                 

Definition
Protein kinase domain containing protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
bmy  Brugia malayi (filaria)
Brite
Enzymes [BR:bmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Bm1_52540
Protein kinases [BR:bmy01001]
 Serine/threonine protein kinases: Other group
  TTK family
   Bm1_52540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 522 aa AA seqDB search
MSTSDLRERLRKLAERTARELQVSQXKKEQGDQNQSAQSDGDKENSVLTAPTNTRMTCTA
PTKLLKNINMVKTPSIPEPAIQDSSLKPSSSAVPCTFTVNNSKTGTSVGIPIEPIIATSK
SPDQIEKVNDSVARCSKSASRSAEDRKKRTASAHVEQSTGPNGDGVATSAVHALRRSESA
STSRPNHYVYVNSHPYVVIDLLGKGGSSKVYQVLDERQKKLRAVKCVDLSEADYCCRSAY
LNEIKLLLSLKDTGCVVEMFDYELHGDFLYVVMEKGDTDLATFLKTRRNQIDDIFIRFYW
SEMLKCVRTIHEKGIVHSDLKPANFLLVGGNLKLIDFGISSAIPTNKTSVMKDTQMGTLS
YMPPEAIAGSNASVHDGKEIYKVRKKCDVWALGCILYNMVYGHTPYQMWTNPIQKMHAIL
NKPIVFEKIEDADLMDVLKRCLTRDPDQRSSVEELQKHPYLTRKVRKCMDESVLPQDDSD
LMKVAEDLRNSTPRTSARKLRDLMQRRDPTTTRKDLVMSKFT
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacttcagacttgcgagaacgtcttcgtaaattagcggagcgtactgctagagaa
ctacaagtctctcaaaasaagaaagaacagggagatcagaatcaaagcgcacaaagtgat
ggcgataaagaaaacagtgtacttacagctccgacaaatacacgcatgacttgtacagct
ccgaccaagcttttaaaaaatattaacatggtcaagacgccatctattccagaacctgca
atacaagattcatcattgaaaccgagtagtagtgcagtaccttgtacatttaccgttaat
aattcgaaaactggaacttctgttggcattcctatagaacccattattgcaacatcaaaa
tcccctgatcaaatcgagaaagttaatgattctgttgcgcggtgtagcaaatcagccagc
agatcagctgaagacaggaaaaaacgaactgctagtgcccatgttgagcaatcaacaggt
ccgaatggtgatggtgtggcaacatcagcagtccacgcattacgtcgttcagaatctgct
tccacttctcgtcctaaccattatgtttacgtaaacagtcatccgtatgttgtgatcgac
ttattgggtaaaggaggctccagtaaagtttatcaagtattagacgaaagacagaagaaa
ttacgtgcagtgaagtgtgttgatttatcggaagctgattattgctgccgcagtgcctac
ttaaacgaaatcaaactgctgcttagtttgaaggatacaggatgtgttgtggagatgttt
gattatgaacttcatggtgatttcttgtatgtagtgatggaaaaaggtgataccgatttg
gcaactttcctgaagactcggaggaatcaaattgatgatatatttatccgattttattgg
agtgaaatgttaaaatgtgtgcgtactattcatgaaaaaggtattgtccattctgatttg
aaaccggcaaattttcttcttgtcggcggaaatctaaaattaatcgattttggaatttcg
tctgctattccaacaaataagacgtcagtaatgaaagacacacagatgggaacactatct
tatatgccgccagaagctattgcaggttcaaatgcttcagtgcatgacggaaaagagatt
tacaaggttcgtaaaaaatgtgatgtatgggctttgggttgcatattgtataacatggtt
tatggacatacgccatatcaaatgtggacaaayccaatccaaaagatgcatgctattttg
aataaaccaatagtttttgagaaaatcgaagatgctgatttaatggatgttttaaaaaga
tgcttaacaagagatcccgaccagcggtctagcgttgaggaattacagaaacatccatat
ttgacgagaaaagttcgtaaatgtatggatgagtcagttttaccgcaggatgacagtgat
ttaatgaaagtggctgaagatttacggaattctacaccgcgaacttcagcacgaaaactt
cgtgatcttatgcaacgacgagatccaacaactacgagaaaagatctagtgatgagcaaa
ttcacttga

DBGET integrated database retrieval system