KEGG   Brugia malayi (filaria): Bm1_52610Help
Entry
Bm1_52610         CDS       T01050                                 

Definition
(RefSeq) RasGEF domain containing protein
  KO
K03099  
son of sevenless
Organism
bmy  Brugia malayi (filaria)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    Bm1_52610
   04012 ErbB signaling pathway
    Bm1_52610
   04068 FoxO signaling pathway
    Bm1_52610
   04150 mTOR signaling pathway
    Bm1_52610
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Bm1_52610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
AA seq 1081 aa AA seqDB search
MFELGKYGGATRHSMSISVGDATFNRSLVANRQSQWKSQKVFIDRIYQISNNCHPGIGLD
QAAAEHIQEILICLFFELLEYHPQTIEDMERNMRTTLPASMFHWVMQFQNTPEALHRIPR
KKLHDKRNANSKSLMSLLHMLQPKLKELLGYKLDEEVMLYLLSVIEYIAADILKWTGNYV
KNIRKCDPTIGLQNLKIALSADTSLMELTEMLYNEEETSTAGILNDNVEDIVQEMSYDEA
SRDFNREEAQYLRDLNLIIHVFRRRFETAFEHDAHCLDEMFGNILELHELTVKVQRMLED
AIEMSDTPCVGAGLWELAEAHEFDVYIAYMLEDRTHSITPGGEAFRLAVKYVLPSLLEIP
VIHFFRYVEFTNILCHLARPPDEIEDLKSTKSYFSGLAVKMESLCPLFLINHLKTEQSVR
ALPESNCSRQRRRIQEIQRSIELWEGKEIGYKCAEVIREGDLLLLRSGPPSSVDTLKKNR
GITMRHTFLFDHLLVLCKTLRSSRPEKPLYKFKDKVLIRKTDIFDLKDTEEFQNAFKIVS
RSITHERGDNTSWTLLCRTPEEKTSWMCDLVKIQAKSSLDRMLDASLKEEEKRVPLILPT
SDQYRFADQDCDENIVFEDYTSSSGIPVVKHGTVLKLVERLTYHLQLLIERFQVPIPPQL
QIAEANSISSLESRELLNGPCAAAHSQGLRIQVSPTVLNRIERSYQRFRKEYQQPIQCRV
LSVIRQWVNNHWYDFEHNPVLLENLCSFLEETDSHGKVINQYKKWCKSIKKRVDIIPSAT
HSGLESEPSPVATTSYGPQKPKILWHIAEKGAIETYDLLSLHPIEIGRQITLLQFDLYKA
IKPIELVGSAWTKRDKDLRSPQLLKLIDHSTMLTYWVARSIVETCSLDERVYMFSRVLEI
MSVFEELNNFTGLVALYSALNSSSVYRLKACWERIDREKQVWYEKFKKLCNPHWKEMIER
LKSINPPCVPFFGHYLSKIFFYEEGNSTFVQSEDLTHEQISADGNTSVVGATGRKVMVSF
VKCRRIASIISDIQMYQNESYALEVEPSIRVSVTANADLNESIEPVAVVVRSASEAGNCK
Q
NT seq 3246 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagctaggaaagtatggtggagccacacgtcattccatgagcatcagcgtgggt
gatgctacctttaatcgctcattagtagctaaccgtcaatcgcagtggaagagtcagaag
gtattcatcgatcggatatatcagatatccaacaattgtcatcctggcatcggactggac
caagcagctgctgaacatatccaagaaatcttgatatgtttattttttgaattactggaa
tatcatccacagacaatcgaggacatggaacgaaatatgcgtaccactttgccggcaagc
atgttccattgggttatgcagtttcaaaatactcctgaagcattacacagaattccacgg
aaaaaacttcatgataaacgaaatgcaaactcaaaaagcctgatgtcacttttgcacatg
ttgcaaccaaaactgaaggaattgctgggttacaaattagatgaggaggtaatgctatac
ttgctttccgttatcgaatacattgctgcagatatactaaagtggactggaaactatgtg
aaaaatataaggaaatgtgatcccactattggtttgcagaatttgaaaattgcgcttagt
gctgatacaagcttgatggagcttacagaaatgttgtacaatgaagaggagacatccaca
gccggaatattaaatgataatgtcgaagatattgtgcaagaaatgtcatatgatgaggca
tcacgcgatttcaatcgtgaggaagctcaatatcttcgtgatcttaatctcatcattcat
gtctttcggcgtcgttttgagactgctttcgagcatgatgcacactgtcttgatgaaatg
tttggcaacattttggaattgcatgaattaacagtgaaggttcagcgaatgttagaagat
gcaattgaaatgtctgatactccatgtgtaggagctggtttatgggaacttgcggaagct
catgaatttgatgtttacattgcttatatgctggaagatcggacacacagtataactcct
gggggtgaagcgtttcgacttgctgttaaatacgtgcttccttctcttctcgaaattcct
gttattcatttctttcgttatgttgagtttacaaatattttatgtcacctggcacgaccg
cctgatgaaatcgaagatttaaaaagcacgaaaagttattttagcggtcttgctgtaaaa
atggagtcgctatgtcctttatttctgattaatcatctgaaaacggaacaaagcgttcgt
gctttgccagaatcaaattgctcacgtcagagacgaaggatccaagaaattcagcgaagc
attgaattatgggaagggaaggaaattggttacaaatgtgcagaagttattagagaaggt
gatttgttactgttgcgatctggaccaccatcttctgttgatacgctgaaaaagaacagg
ggaataactatgcgtcatacatttctcttcgatcatcttttggtgctttgtaaaacatta
cgctcttcaaggccagagaaaccactttataaatttaaggataaagtgcttatacgtaaa
actgatatattcgatctaaaagatactgaagaatttcaaaatgcctttaaaattgtatcg
cgatcgataactcatgaacgaggagacaacacttcctggactttgctttgtcgaacgccg
gaagagaaaactagttggatgtgcgatttagtcaaaattcaggcgaaaagttcattagat
cgaatgttggatgcatcgttgaaagaagaagaaaaacgagttccactaattttgccgaca
tctgaccagtataggttcgctgatcaagactgcgatgaaaatattgtgtttgaagattat
acatcaagtagtgggataccagtcgttaagcatggaactgttctaaaacttgttgaacgc
ttaacttatcacttgcaattgctcatcgaacgttttcaagtacctattccgccacaactc
caaatagctgaagcgaatagtatatctagtttggagtcacgtgagcttttaaatggtcct
tgtgccgcagcacattctcaaggtctgaggatccaagtttctccgacagtgctaaataga
attgagcgaagttatcagcgatttcgcaaagaatatcagcaaccaatacagtgcagagta
ctaagtgtgattcgacagtgggtcaataaccactggtatgatttcgagcataatcccgtt
ttgttggaaaacttatgttcgtttttggaagaaactgattctcatggaaaagttatcaat
cagtacaagaaatggtgtaagagcattaagaaacgagttgatataataccgtcggcgaca
catagtggtttagaaagtgaaccttccccagtggcaaccacttcgtatggtccacagaaa
ccgaagattttgtggcatattgccgagaaaggagccatcgaaacgtacgatctcttgtca
ttacatccaattgaaattggtcgacagataaccctgttacaatttgacctttataaagct
attaaacccatcgaattggttggttcagcatggacgaaaagggataaagatcttagaagt
ccacaattgcttaagctcatcgatcatagtactatgttaacttattgggttgctcgctct
attgtggaaacttgttcattggacgagcgagtatatatgttctcacgtgtgctagaaata
atgtctgttttcgaagaactcaacaatttcactggactcgttgctttatattctgctctg
aatagtagctctgtatatcggcttaaggcatgttgggagagaattgatcgggaaaagcaa
gtatggtatgaaaaattcaagaaactgtgcaatccgcactggaaagaaatgattgaacga
ttgaaaagtataaatccgccttgtgtcccattttttggtcattatctttccaaaatcttt
ttttacgaggaagggaacagtacatttgtacagagcgaagatctcactcatgagcagatt
agtgctgatggtaacacatcagtcgtgggtgcaacaggtcgtaaagtgatggtgtctttt
gtgaaatgccgtcggatagcatcaattatcagtgatatccaaatgtatcaaaatgaatcg
tatgcattggaagtggagccaagtataagggtatcagttactgccaacgcggatttaaac
gaatcaattgaaccagtagcagttgtggtaagaagcgcctctgaggccggcaattgcaaa
cagtaa

DBGET integrated database retrieval system