KEGG   Brugia malayi (filaria): Bm1_52610Help
Entry
Bm1_52610         CDS       T01050                                 

Definition
RasGEF domain containing protein
Orthology
K03099  
son of sevenless
Organism
bmy  Brugia malayi (filaria)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    Bm1_52610
   04012 ErbB signaling pathway
    Bm1_52610
   04630 Jak-STAT signaling pathway
    Bm1_52610
   04068 FoxO signaling pathway
    Bm1_52610
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Bm1_52610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1081 aa AA seqDB search
MFELGKYGGATRHSMSISVGDATFNRSLVANRQSQWKSQKVFIDRIYQISNNCHPGIGLD
QAAAEHIQEILICLFFELLEYHPQTIEDMERNMRTTLPASMFHWVMQFQNTPEALHRIPR
KKLHDKRNANSKSLMSLLHMLQPKLKELLGYKLDEEVMLYLLSVIEYIAADILKWTGNYV
KNIRKCDPTIGLQNLKIALSADTSLMELTEMLYNEEETSTAGILNDNVEDIVQEMSYDEA
SRDFNREEAQYLRDLNLIIHVFRRRFETAFEHDAHCLDEMFGNILELHELTVKVQRMLED
AIEMSDTPCVGAGLWELAEAHEFDVYIAYMLEDRTHSITPGGEAFRLAVKYVLPSLLEIP
VIHFFRYVEFTNILCHLARPPDEIEDLKSTKSYFSGLAVKMESLCPLFLINHLKTEQSVR
ALPESNCSRQRRRIQEIQRSIELWEGKEIGYKCAEVIREGDLLLLRSGPPSSVDTLKKNR
GITMRHTFLFDHLLVLCKTLRSSRPEKPLYKFKDKVLIRKTDIFDLKDTEEFQNAFKIVS
RSITHERGDNTSWTLLCRTPEEKTSWMCDLVKIQAKSSLDRMLDASLKEEEKRVPLILPT
SDQYRFADQDCDENIVFEDYTSSSGIPVVKHGTVLKLVERLTYHLQLLIERFQVPIPPQL
QIAEANSISSLESRELLNGPCAAAHSQGLRIQVSPTVLNRIERSYQRFRKEYQQPIQCRV
LSVIRQWVNNHWYDFEHNPVLLENLCSFLEETDSHGKVINQYKKWCKSIKKRVDIIPSAT
HSGLESEPSPVATTSYGPQKPKILWHIAEKGAIETYDLLSLHPIEIGRQITLLQFDLYKA
IKPIELVGSAWTKRDKDLRSPQLLKLIDHSTMLTYWVARSIVETCSLDERVYMFSRVLEI
MSVFEELNNFTGLVALYSALNSSSVYRLKACWERIDREKQVWYEKFKKLCNPHWKEMIER
LKSINPPCVPFFGHYLSKIFFYEEGNSTFVQSEDLTHEQISADGNTSVVGATGRKVMVSF
VKCRRIASIISDIQMYQNESYALEVEPSIRVSVTANADLNESIEPVAVVVRSASEAGNCK
Q
NT seq 3246 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagctaggaaagtatggtggagccacacgtcattccatgagcatcagcgtgggt
gatgctacctttaatcgctcattagtagctaaccgtcaatcgcagtggaagagtcagaag
gtattcatcgatcggatatatcagatatccaacaattgtcatcctggcatcggactggac
caagcagctgctgaacatatccaagaaatcttgatatgtttattttttgaattactggaa
tatcatccacagacaatcgaggacatggaacgaaatatgcgtaccactttgccggcaagc
atgttccattgggttatgcagtttcaaaatactcctgaagcattacacagaattccacgg
aaaaaacttcatgataaacgaaatgcaaactcaaaaagcctgatgtcacttttgcacatg
ttgcaaccaaaactgaaggaattgctgggttacaaattagatgaggaggtaatgctatac
ttgctttccgttatcgaatacattgctgcagatatactaaagtggactggaaactatgtg
aaaaatataaggaaatgtgatcccactattggtttgcagaatttgaaaattgcgcttagt
gctgatacaagcttgatggagcttacagaaatgttgtacaatgaagaggagacatccaca
gccggaatattaaatgataatgtcgaagatattgtgcaagaaatgtcatatgatgaggca
tcacgcgatttcaatcgtgaggaagctcaatatcttcgtgatcttaatctcatcattcat
gtctttcggcgtcgttttgagactgctttcgagcatgatgcacactgtcttgatgaaatg
tttggcaacattttggaattgcatgaattaacagtgaaggttcagcgaatgttagaagat
gcaattgaaatgtctgatactccatgtgtaggagctggtttatgggaacttgcggaagct
catgaatttgatgtttacattgcttatatgctggaagatcggacacacagtataactcct
gggggtgaagcgtttcgacttgctgttaaatacgtgcttccttctcttctcgaaattcct
gttattcatttctttcgttatgttgagtttacaaatattttatgtcacctggcacgaccg
cctgatgaaatcgaagatttaaaaagcacgaaaagttattttagcggtcttgctgtaaaa
atggagtcgctatgtcctttatttctgattaatcatctgaaaacggaacaaagcgttcgt
gctttgccagaatcaaattgctcacgtcagagacgaaggatccaagaaattcagcgaagc
attgaattatgggaagggaaggaaattggttacaaatgtgcagaagttattagagaaggt
gatttgttactgttgcgatctggaccaccatcttctgttgatacgctgaaaaagaacagg
ggaataactatgcgtcatacatttctcttcgatcatcttttggtgctttgtaaaacatta
cgctcttcaaggccagagaaaccactttataaatttaaggataaagtgcttatacgtaaa
actgatatattcgatctaaaagatactgaagaatttcaaaatgcctttaaaattgtatcg
cgatcgataactcatgaacgaggagacaacacttcctggactttgctttgtcgaacgccg
gaagagaaaactagttggatgtgcgatttagtcaaaattcaggcgaaaagttcattagat
cgaatgttggatgcatcgttgaaagaagaagaaaaacgagttccactaattttgccgaca
tctgaccagtataggttcgctgatcaagactgcgatgaaaatattgtgtttgaagattat
acatcaagtagtgggataccagtcgttaagcatggaactgttctaaaacttgttgaacgc
ttaacttatcacttgcaattgctcatcgaacgttttcaagtacctattccgccacaactc
caaatagctgaagcgaatagtatatctagtttggagtcacgtgagcttttaaatggtcct
tgtgccgcagcacattctcaaggtctgaggatccaagtttctccgacagtgctaaataga
attgagcgaagttatcagcgatttcgcaaagaatatcagcaaccaatacagtgcagagta
ctaagtgtgattcgacagtgggtcaataaccactggtatgatttcgagcataatcccgtt
ttgttggaaaacttatgttcgtttttggaagaaactgattctcatggaaaagttatcaat
cagtacaagaaatggtgtaagagcattaagaaacgagttgatataataccgtcggcgaca
catagtggtttagaaagtgaaccttccccagtggcaaccacttcgtatggtccacagaaa
ccgaagattttgtggcatattgccgagaaaggagccatcgaaacgtacgatctcttgtca
ttacatccaattgaaattggtcgacagataaccctgttacaatttgacctttataaagct
attaaacccatcgaattggttggttcagcatggacgaaaagggataaagatcttagaagt
ccacaattgcttaagctcatcgatcatagtactatgttaacttattgggttgctcgctct
attgtggaaacttgttcattggacgagcgagtatatatgttctcacgtgtgctagaaata
atgtctgttttcgaagaactcaacaatttcactggactcgttgctttatattctgctctg
aatagtagctctgtatatcggcttaaggcatgttgggagagaattgatcgggaaaagcaa
gtatggtatgaaaaattcaagaaactgtgcaatccgcactggaaagaaatgattgaacga
ttgaaaagtataaatccgccttgtgtcccattttttggtcattatctttccaaaatcttt
ttttacgaggaagggaacagtacatttgtacagagcgaagatctcactcatgagcagatt
agtgctgatggtaacacatcagtcgtgggtgcaacaggtcgtaaagtgatggtgtctttt
gtgaaatgccgtcggatagcatcaattatcagtgatatccaaatgtatcaaaatgaatcg
tatgcattggaagtggagccaagtataagggtatcagttactgccaacgcggatttaaac
gaatcaattgaaccagtagcagttgtggtaagaagcgcctctgaggccggcaattgcaaa
cagtaa

DBGET integrated database retrieval system