KEGG   Brugia malayi (filaria): Bm1_52680Help
Entry
Bm1_52680         CDS       T01050                                 

Definition
L-isoaspartate
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bmy  Brugia malayi (filaria)
Brite
Enzymes [BR:bmy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Bm1_52680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 319 aa AA seqDB search
MSPWFCLFMLITANCVLLAVFVSTSDCDSLKDNFCSKERQRLSSSRKEFIKSVSAGEERE
GENLHPEREKQIKSRKMKIFEDATRLLTRNIRNAMAWMSGADSNVALVNNLQSNNLFKDK
RVRDAMLKVDRADFTAITPYGDHPVSIGYGATISAPHMHASSLELLKDHLKEGNRALDVG
SGSGYLTACMAVMVGKXGKVVGIDHIQALVDDSRRNIMKHHADLFTNHRIILVQGDGRKG
YAKEAPYNAIHVGAAAPEIPVQLIEQLAKGGRMLIPVGPEGGPQRFVQVDKDTDGNVTQK
DLMGVIYVPLTDQQHQLHN
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtctccttggttctgtttatttatgctaattactgctaattgtgtactactggctgtg
tttgtttccacttctgattgcgatagtttaaaggacaacttctgcagtaaagaacgacag
aggttgagcagtagtcgaaaagaattcattaaatcagtttctgcaggagaggaaagagag
ggtgaaaatttacacccagaaagagagaaacaaataaaatccagaaaaatgaagatattc
gaggatgctacacgactactaactcgcaacataagaaacgcaatggcttggatgtccggt
gccgattcgaatgttgctttggtcaataatttacagagcaataatttattcaaggataag
cgtgtaagagatgctatgctgaaggtggatcgagctgatttcacagctataacgccgtac
ggcgatcatcccgtttcaatcggttacggcgctacgattagtgccccgcatatgcatgcg
tcttcactagagcttctgaaggatcatctgaaagaagggaatcgagcgctggacgtagga
tcaggttccggttacttaacagcctgtatggcggtaatggttggtaaaayaggaaaagta
gttggcatagatcatattcaagctttggtggatgattcaaggcgtaatatcatgaaacat
catgcagatttattcactaatcaccgcataattcttgtacaaggagatggtaggaaaggt
tatgcaaaagaagcaccgtataatgctattcatgtcggagctgctgcacctgaaatccct
gttcagttaatagagcagcttgctaaaggtggaaggatgctgattccggtcggtcctgaa
ggtggtcctcagcggtttgtacaggttgacaaggatactgacggtaatgtaacgcaaaaa
gacttaatgggtgtaatatatgttcctttaactgatcaacagcaccagcttcataactga

DBGET integrated database retrieval system