KEGG   Brugia malayi (filaria): Bm1_52855Help
Entry
Bm1_52855         CDS       T01050                                 

Definition
(RefSeq) Viral A-type inclusion protein repeat containing protein
  KO
K12478  early endosome antigen 1
Organism
bmy  Brugia malayi (filaria)
Pathway
bmy04144  Endocytosis
bmy04145  Phagosome
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Bm1_52855
   04145 Phagosome
    Bm1_52855
Membrane trafficking [BR:bmy04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    Bm1_52855
 Protein recycling
   Others
    Bm1_52855
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FYVE zf-C2H2_4
Motif
Other DBs
NCBI-GeneID: 6105454
NCBI-ProteinID: XP_001902039
AA seq 1051 aa AA seqDB search
MLRKLKTQVTQAVNSVTPSEPQHEPLFNESSTPSEGFLCPVCMHSFSSPDELQVHFRVHA
IKQVGKQKLTGSFSFSSLENGFNESDALHLELDMKELKSQLQDEKRYSVELKKELDRLHG
LIANQTEISEDEIPYLTQQMQMLEAGKALATERMLEMEKETRGMSRQVEQLKQEKSRLIE
KIGELLTKIASKTDEIEEKNNEKALLGDELVRYREEIQNLELEIEDLRRKLDQRPSEDDV
SVLRKELVHAQQLMDTITQEKEEKIKKDVGTIRNMEQDHKKLTGEIAILKSNIEALKNTI
SRYDGGSERLIGEINAFRKVWEEKATNSAERILDACRKIDDLEITVNGCRKKIIDNGTEK
NKLSELEDARNSLLEVEKERNSLQQEIVSLFALLDEQKQNYAEKKIQIIKNEETISEHRK
EIEQLKKNISKLEASLNEASTIEGILKQNLKEAKAKESLLMQKISEGNGVENLAMKQMHK
EKMALEETVNRLNETLKSLNTSHENAISQHEESWKKNIEAEKEKMKKLENELSNLHCNYI
SAEEKNKKLSALLEERTTTSEEKNKIIETERIKLKSAVEKLALMEEKALQLDSELREKET
AAIRRNEEYMQLKETMKEMQSEMKEIKIAKKKLECDLAEQRESSKENVCQLQKELFTCEQ
EKIVLKEQFENILQQFSALNEECSRCKDNEVELLENMSQKELLIKELEQNIRSLMAGLEC
ERHNHDKSIKDLQYELSQLQQENTAILTAKERVIFLFLVILIAIFHKELVIQMETVSELK
EELHAKERQLSDIMQEMERVRNELRSKEEGRYTLENDALKLKRQNVELRKELDQLEKSTS
QLKNDFEKETNLLKNSLENCEKNKEESLSRLHVQLEAEKNRLKEISKDNEEKDEILKRIN
DDLKKANEDSNKLIILQSELEKKKTEWLQEKRALQERCLTAENDLEFERERAIVNKRNFD
DVQTAIRELGRVNQNLQMDFAKQISRKWLEDSEAINCHTCDKPFTLTNRKHHCRQCGQIF
CASCSSFTAKIASSRNPVRVCNACHEEIMHR
NT seq 3156 nt NT seq  +upstreamnt  +downstreamnt
atgttacgtaaactgaaaacgcaggtgacgcaagccgtaaacagtgttactccctccgag
cctcaacacgagccactatttaatgaaagtagcacaccttcagaaggatttttatgtccc
gtatgcatgcattcattttcttctccagatgagttgcaggtgcattttcgagtgcatgca
attaaacaggttggaaagcaaaaactcactggttccttctcatttagttcacttgagaat
ggttttaatgaatcagatgcacttcatctcgagttggacatgaaagaacttaaatcgcaa
ctgcaagacgagaagcgctattcagtggaattaaaaaaagagcttgataggttgcatggt
ctcatcgcaaatcaaacagaaatatctgaggacgaaataccttatcttacacagcaaatg
caaatgctcgaagctggcaaagccttagcaacagaacgaatgcttgaaatggaaaaagaa
acaagggggatgagccgacaggttgaacaactgaagcaagaaaaaagtaggttgatcgaa
aaaattggagaacttttgacaaagattgccagtaaaacagatgaaatcgaagagaaaaat
aacgaaaaagctcttctgggtgatgagctagtgcgctacagggaagagatacagaatttg
gaactagaaatcgaagacttacgacgaaaactcgatcaaagaccatcagaagatgacgtc
agcgtgcttaggaaagaactagtacatgcacagcaactaatggacacaataacacaggaa
aaagaagaaaaaattaagaaagatgtcggtacaatacgcaatatggagcaagatcataaa
aagttaacaggtgaaattgcgattttaaaaagtaatattgaagccctcaagaatacgatt
tccagatatgatggtggatctgagagacttatcggagaaatcaacgctttcagaaaagtt
tgggaagagaaagccacaaattcagctgaaagaatccttgatgcttgtaggaaaatcgac
gatttagaaattactgtgaatggatgccggaaaaaaatcatagataatgggactgaaaaa
aacaagttgtcggaacttgaagatgcaagaaattctctactggaggtggaaaaagaacgt
aatagtttacaacaagaaatcgtgtcattattcgctttgctggatgaacaaaagcagaat
tatgcggaaaaaaaaatacaaataattaagaatgaggaaacgatatctgagcatcgaaaa
gaaattgaacaattgaagaaaaacatttccaaattggaagcttctttgaacgaagcatcc
acaatcgaaggtatactgaagcagaatttgaaagaagcaaaggcgaaggaatcacttctg
atgcaaaaaatttctgaaggcaacggagtggagaatttagcaatgaaacaaatgcataag
gagaaaatggcactcgaggaaacagtaaataggttgaatgaaactttgaagtctttaaat
acctcgcatgaaaatgcaatatctcagcatgaagagagctggaaaaagaatatagaggct
gaaaaggagaaaatgaagaagctagaaaatgaactgagcaatttgcactgtaattacatt
tctgctgaggaaaagaataaaaaattatctgcattgctagaagaaagaacgacgacaagt
gaggaaaagaataaaataatcgaaacggaacgtatcaaattgaagtcagctgttgaaaag
ctcgcactaatggaggaaaaagccttacagttggatagcgaactgcgtgaaaaagaaact
gctgccatcaggcgtaatgaagaatatatgcaattaaaagaaacaatgaaagagatgcaa
tcagaaatgaaggaaataaaaatagcgaaaaaaaagttagaatgcgatttagcggaacaa
agagaaagttcgaaggagaatgtatgccaactgcagaaagaacttttcacatgtgaacaa
gagaaaattgtgctaaaggaacaatttgaaaatattttgcagcaattttctgctctgaat
gaagaatgttcaagatgtaaggataatgaagttgaattattggaaaacatgagccaaaaa
gaactattaataaaggaattagaacaaaatatcaggagtttaatggctggattggaatgt
gaaaggcataatcatgataagtctataaaagatttgcagtatgaactaagccaacttcaa
caggaaaatacggcaatattgaccgcgaaagaaagagttatatttttgtttctcgtgata
ttgattgcgatatttcataaagaattggtgattcaaatggaaacagtttctgaattgaag
gaggaacttcatgctaaggagaggcagttatctgacataatgcaggagatggaaagggta
cgtaatgaattgcgctcaaaagaagaaggaagatatactctggaaaatgacgcattaaaa
ttgaagaggcaaaacgtggagttgcggaaggaattggatcagcttgaaaaaagcacatca
caactcaaaaatgattttgaaaaagaaactaatttgctgaaaaacagtttggaaaactgt
gaaaagaataaagaagaaagcctgtcgagacttcatgtgcagttggaagcagaaaaaaat
aggctaaaggagatttcaaaagataatgaagaaaaagatgaaattttgaagcgtataaat
gatgatttaaaaaaggccaatgaagattcaaataaattaatcattcttcaaagcgaattg
gagaaaaagaaaacagaatggttacaagaaaaacgagcattgcaagaaaggtgtttaaca
gcagaaaatgatctggagtttgaacgcgagcgagctattgtaaacaagagaaatttcgat
gatgttcaaactgctattcgrgaacttggacgagtgaatcaaaatttgcagatggatttt
gcaaagcaaatatcacgtaaatggttggaagattcagaggccataaattgtcatacttgt
gacaaaccatttactcttacaaatcgcaaacatcattgtagacaatgtggacaaatattt
tgtgcctcgtgttcgtcgttcacagctaaaattgcgtcatcaagaaatccggttcgtgtt
tgtaatgcatgtcacgaagaaattatgcatcgataa

DBGET integrated database retrieval system