KEGG   Brugia malayi (filaria): Bm1_53060Help
Entry
Bm1_53060         CDS       T01050                                 

Definition
diaphorase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
bmy  Brugia malayi (filaria)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bm1_53060
Enzymes [BR:bmy01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     Bm1_53060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 320 aa AA seqDB search
MVSNYESAVTNVTLITGSVILVSSLVLYHFLYRRSGIHCKLYSLFGITRKKLITLVDSEA
TYPLALMQKEIVNHDTRRFRFKLPTNEHVLGLPVGQHIHLSAKINEKLVVRPYTPISSDD
DKGYVDLMVKIYFNNVHPKFPDGGKMTQYLEKMKIGETINFRGPSGLIVYEGNGSFAVKS
TKKAEPKSHVYKNIGMIAGGSGITPMLQIISAIMKDPDDCTKVSLIFANKDESDILLRDE
LDRLAAEHSEKFRVWYTIDQAKPGWIYSTGFVNAEMIQKHLPEPGSGTVILMCGPPPMIK
FACTPSLDKLGYSESDRLIF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggtttcgaactacgagagcgctgtaactaacgtgacacttattacgggttccgtcata
cttgtttcttcactagtgctatatcattttttatatcgacgtagtggtatccactgtaaa
ctctattcgctttttggtattacgagaaagaaattaataactcttgtggattcggaagca
acatatcctctagctttaatgcaaaaagaaattgttaaccacgatacgcgaagatttcgt
ttcaagctacccactaatgagcacgttcttggcttgcctgttggccaacacatccacctt
tctgcaaagataaacgaaaagcttgttgttcgtccatatactccaatttcatccgatgat
gacaaaggatatgtcgatttgatggtcaagatttattttaataacgttcatcccaagttt
ccggatggtggaaagatgacacagtatcttgagaaaatgaagataggtgaaacaattaat
tttcgcggtccctcgggattaattgtttatgaagggaatggatcctttgctgtgaagtca
acgaaaaaagcagaaccgaaaagtcatgtgtacaaaaatattggtatgattgctggcggc
agcggtatcacgccaatgttgcaaattatctcagcaattatgaaagatccggatgattgt
accaaggtttcattgatttttgctaacaaagatgaatccgatatattgcttagagatgag
ttagataggttagctgcggagcattcagagaagttccgtgtgtggtacaccatcgatcag
gcaaaacctggctggatatactcgacaggatttgtgaacgcagaaatgattcaaaagcat
ttgccggaacctggaagtggcacggtaattttgatgtgcggcccaccgccaatgatcaag
tttgcctgtacaccaagcctcgataagttaggttattcggagagtgaccgtttaattttt
taa

DBGET integrated database retrieval system