KEGG   Brugia malayi (filaria): Bm1_53060Help
Entry
Bm1_53060         CDS       T01050                                 

Definition
diaphorase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
bmy  Brugia malayi (filaria)
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bmy00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 320 aa AA seqDB search
MVSNYESAVTNVTLITGSVILVSSLVLYHFLYRRSGIHCKLYSLFGITRKKLITLVDSEA
TYPLALMQKEIVNHDTRRFRFKLPTNEHVLGLPVGQHIHLSAKINEKLVVRPYTPISSDD
DKGYVDLMVKIYFNNVHPKFPDGGKMTQYLEKMKIGETINFRGPSGLIVYEGNGSFAVKS
TKKAEPKSHVYKNIGMIAGGSGITPMLQIISAIMKDPDDCTKVSLIFANKDESDILLRDE
LDRLAAEHSEKFRVWYTIDQAKPGWIYSTGFVNAEMIQKHLPEPGSGTVILMCGPPPMIK
FACTPSLDKLGYSESDRLIF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggtttcgaactacgagagcgctgtaactaacgtgacacttattacgggttccgtcata
cttgtttcttcactagtgctatatcattttttatatcgacgtagtggtatccactgtaaa
ctctattcgctttttggtattacgagaaagaaattaataactcttgtggattcggaagca
acatatcctctagctttaatgcaaaaagaaattgttaaccacgatacgcgaagatttcgt
ttcaagctacccactaatgagcacgttcttggcttgcctgttggccaacacatccacctt
tctgcaaagataaacgaaaagcttgttgttcgtccatatactccaatttcatccgatgat
gacaaaggatatgtcgatttgatggtcaagatttattttaataacgttcatcccaagttt
ccggatggtggaaagatgacacagtatcttgagaaaatgaagataggtgaaacaattaat
tttcgcggtccctcgggattaattgtttatgaagggaatggatcctttgctgtgaagtca
acgaaaaaagcagaaccgaaaagtcatgtgtacaaaaatattggtatgattgctggcggc
agcggtatcacgccaatgttgcaaattatctcagcaattatgaaagatccggatgattgt
accaaggtttcattgatttttgctaacaaagatgaatccgatatattgcttagagatgag
ttagataggttagctgcggagcattcagagaagttccgtgtgtggtacaccatcgatcag
gcaaaacctggctggatatactcgacaggatttgtgaacgcagaaatgattcaaaagcat
ttgccggaacctggaagtggcacggtaattttgatgtgcggcccaccgccaatgatcaag
tttgcctgtacaccaagcctcgataagttaggttattcggagagtgaccgtttaattttt
taa

DBGET integrated database retrieval system