KEGG   Brugia malayi (filaria): Bm1_53420Help
Entry
Bm1_53420         CDS       T01050                                 

Definition
Glycogen synthase
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
bmy  Brugia malayi (filaria)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bm1_53420
Enzymes [BR:bmy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Bm1_53420
Glycosyltransferases [BR:bmy01003]
 Polysaccharide
  Storage polysaccharide
   Bm1_53420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 262 aa AA seqDB search
GRIPDMEDLLLPDERIQLKRCILSAKRDNLPPICTHNMLDDACDPVLNAFRRTQLINQPF
DRVKVIFHPEFLSSVSPLMNLDYEDFVRGCHMGVFPSYYEPWGYTPAECTVMGVPSVTTN
LSGFGCFIQEQVQDPHTFGIFVIDRRFKEPNASIDELAKTLYDFTLLSRRQRIIMRNRTE
RLSELIDWKTLGTFYREARRKALEVTHPNFMQVIEETVKKMSRPTSAPSTPTTSRSVSPY
DSDESDTAEQEAFEAKAWAEAN
NT seq 790 nt NT seq  +upstreamnt  +downstreamnt
aggtcgtataccagatatggaggatttactacttccagatgaacgtatccaattaaagcg
ttgcatactaagtgcaaagcgtgataatttgcctccaatatgtacgcataatatgcttga
tgatgcttgtgatcccgtattaaatgctttccgacgtactcaacttataaatcaaccgtt
tgatcgcgttaaagtaatattccatccggaatttctatcatctgtttcacccttaatgaa
tttggattacgaagattttgttcgcggttgtcacatgggtgtttttccaagttactatga
accatggggttatacaccagctgaatgtacggtaatgggtgttccatcagttacaaccaa
tctatccggatttggwtgttttattcaggagcaagtgcaggatcctcatacattcgggat
ttttgttattgatcgccgttttaaagaacctaatgcatctattgatgaacttgcaaaaac
tctttatgattttacattactttctcgtcgtcagcgtattattatgcgaaatcgaacgga
aagattaagcgaacttatagattggaaaactcttggaacattttatcgtgaagcacgacg
aaaagcactggaagttacgcatccaaatttcatgcaagtaatcgaagaaactgttaaaaa
aatgtcacgaccaacatcagcaccatcaacaccgactacaagtcgatcggtgtcaccata
cgatagcgatgaatcagacaccgcggaacaagaagcatttgaagcaaaagcatgggcgga
agctaattag

DBGET integrated database retrieval system