KEGG   Brugia malayi (filaria): Bm1_53635Help
Entry
Bm1_53635         CDS       T01050                                 

Definition
Ubiquitin carboxyl-terminal hydrolase family protein
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
bmy  Brugia malayi (filaria)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 656 aa AA seqDB search
MAQIDPTALIQAYIPFAKSSQSLDSEKQSMMRSAAKNCTVLNSSVSNSGQSTSRTCEIVE
RERGYEMAASANSGSTSNHAPPSFDSTGLRMIQTNYRDSSSSPRSPPARCAKRLKNNSST
SSARSSSVSSTVSTLSAVINLNNQSPKSHAVSDTPHKSAGKHLNNANSIQANVGSTKLTK
YFARDMLHGTNNVRRLNSPPVRINSHLDLANHNGYDDNRPSTSKCFTSGSKILLNGAVKR
RMDINTSHTSTRKMESQGNRILNGKAEGKRLIPESSELETRFPANSRTVFYATWEGSRVL
NPDGRNVGVGLCNYSNDCFLNAVLQIILHCIPFARYLGEHLPLFSCVKDCVACGLARFIR
YSMSSRQPFKPAWISFILEKAFPSHLLGAQEDAHEALNHILDALDSEARNGMSSSDRNFS
DPLNGPRFSTPVEQLFVGTLRNQIQCSACSAILINYERFRELNLGIKKTGYDRRITLEDL
LDDYFGSEVLNSFKCTNCKRTTQIQRSSRILRAPNLLLIQIKRFNSFGGKIGVHVNFNLR
LDLEQYIHRGGESHVYELTGIVQHMGNAVEHGHYIAVVRGFDGRSYYMFDDEQRHRVSLS
ELHNTQAYMLLYVRCDAFRNSVSSSVALSAANETQNDAPTRNRVMKRPYIQISMDT
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaattgatcccactgcattgattcaagcatatattccatttgctaaatcaagt
caaagtcttgattctgaaaaacaatcaatgatgcgatctgctgcgaagaattgcactgta
ctaaattcgtcggtgtctaattcaggacaaagcacgtcaagaacatgcgaaattgttgaa
cgtgaacgtggatacgaaatggctgccagtgctaattctgggtcaacctcaaatcatgca
ccaccgtcatttgactctacaggactacgtatgattcaaacgaattatcgagatagttcg
tcatcaccacgttcacctccagctcgatgcgccaagcggttaaaaaataattcatccaca
tcgtcagcgcgtagctcaagtgtgagcagtactgttagtacgttatcagcagttattaat
cttaataatcaatcgccaaaaagtcatgctgtctcggacactccacataaaagtgcagga
aaacatctgaacaatgcaaattctatccaagcgaatgttggatcgacaaaactcacgaag
tattttgctcgagacatgctccatggcacaaataatgttagacgacttaattctccgcca
gttcgcattaactctcacctggatcttgcaaatcataatggctatgatgataacagacca
tcaacgtctaaatgttttacatcgggatcgaagatcctactaaatggtgcagtaaaacgg
cgtatggacataaatactagtcacacttccaccagaaaaatggaatctcagggtaataga
attctgaacggtaaagctgaagggaaacgattgataccagaaagcagcgaattggaaacc
agattccctgcaaatagtcgtacagtattttatgcaacatgggaaggcagccgtgttctg
aatccggatggtcgtaatgttggtgttggactttgtaactattccaacgactgcttttta
aacgctgttcttcagattattttgcactgcattccgtttgcacgatatcttggcgagcat
ctccccttattttcttgtgtgaaggattgtgtcgcttgtggtctggcgagatttataagg
tattcaatgtcgagcagacaaccattcaaaccagcttggattagtttcattctagaaaag
gcatttccatctcacctgttaggtgcacaggaagatgctcatgaagctctgaatcacata
ctggatgctctcgattcagaagcacggaatggaatgtcctcttctgatcgtaatttctca
gatccattgaatggaccacgcttttcaacaccagtggaacaactttttgtcgggacatta
cgaaatcaaattcagtgttcggcttgttccgcaatactaataaattacgagcgctttcgg
gagcttaaccttggcataaagaaaacaggttatgataggcggataactttggaggatttg
ctcgacgattattttggcagcgaagtgttgaacagttttaaatgcactaactgtaagagg
acgacgcaaattcaacgtagttcacgtattctgcgtgcaccgaaccttttacttatccag
ataaaacggttcaattcgtttggtggaaaaataggcgttcatgttaatttcaatttgagg
ctggatctcgaacaatatattcatcgtggaggagaatcacatgtttacgaacttactggt
attgttcaacatatgggtaatgcagtggaacatggtcattatattgctgttgtaagaggt
tttgatggtagaagttattatatgttcgatgatgaacagcgtcacagagtttctctatct
gaactgcacaatacacaggcgtacatgctgttgtacgttcgttgtgatgcattcaggaat
tccgtctcatcttcggtagcattgagtgctgcaaatgaaacacagaacgatgcacctacc
aggaatcgagtgatgaagcgtccatatatacaaatatcaatggatacttaa

DBGET integrated database retrieval system