KEGG   Brugia malayi (filaria): Bm1_53640Help
Entry
Bm1_53640         CDS       T01050                                 

Definition
putative malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
bmy  Brugia malayi (filaria)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Bm1_53640
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bm1_53640
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    Bm1_53640
Enzymes [BR:bmy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Bm1_53640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 476 aa AA seqDB search
MFSRSFTPNLLFLIGQRNAITRKLFAVTFGPHYRVTAKGYQANSTTVRDIYSKLTSYSSS
DQWRDAGEQLVEKYFASSMLYRRSILVELSQNFGVDHAILKRSIELYHKNEQAFMNVASA
SRPHYFRLFQSIGNMTGGVERICSMRADLLGMLCSSDLTRTDSAALRPVENCFRELLTLW
FCQSNLRLQQLTIESPGDILDKVMKYEAVHPITGLIDMKRRLGPNRRCFVFMHEAMAREP
LVVVYAAFMKKIAKNLEDIMNDADIFEDENVSDTAIFYSISSTQAGLRGIDLGNMLIKRV
IAEISNTNPHIRVFATLSPMPYFRSWLLRSLKCAAPSVDVIDERLLEICEENEFFEGDIR
IVELVRLFLLDHLNRVNASKYEKIFEIIMHLAVRYLLEAKHSATGRAFDPVENFHLRNGA
EIYAVNWKADTTTKGMESSYGVMVNYLYRLDQVMKNSTQYIQKGEIAINSDALALL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtttagtcgatcatttacacctaatttattatttctgatagggcagaggaatgctatt
acaagaaaattgttcgcagttactttcggtcctcattatcgtgtaacagccaaagggtat
caagctaattcaacgactgtcagagatatatatagcaaacttacgtcttattcatcatcc
gaccaatggcgtgatgctggagaacagctagtcgaaaagtattttgcatcatcgatgtta
taccgacgttctattttggttgaactttcgcagaattttggtgtagatcatgcaatactt
aaacgatccattgaactctaccataaaaatgaacaagcatttatgaatgttgcttcagca
tcacgtccacattattttcgacttttccaatctattggcaacatgacaggcggtgtggaa
aggatatgttcgatgcgtgctgatcttttgggaatgctctgttcttcggatttgacgcga
actgatagtgcagcgttacgaccggtcgaaaattgttttcgtgaattactgacgctttgg
ttttgtcaaagtaatttgcgtttgcaacaactgacgattgaatcaccgggtgacattctt
gataaagttatgaaatatgaagctgtgcatccaataaccggtttgatagatatgaaacga
cgccttggtcctaatcgacgttgctttgtgtttatgcatgaagcaatggctcgtgaaccg
ttggttgttgtttatgccgcatttatgaaaaagattgccaaaaatcttgaagatataatg
aatgacgccgatatatttgaggatgaaaatgtaagtgatacagcgatcttttattcgata
tcatcaacacaagcaggtttgcgtggtatcgatctgggtaatatgttgataaagcgggta
attgcagagatttcaaacaccaacccgcacatacgcgtatttgcaactttatcacctatg
ccgtattttcgtagctggcttttacgatcccttaaatgtgcagcaccatctgtagatgtg
attgatgaaagattattggaaatttgtgaggaaaatgaattctttgaaggcgacattaga
atagtcgagctcgtacgattgtttcttttggatcatttgaacagagttaatgctagcaaa
tatgaaaaaattttcgagattattatgcatttagcggttcggtatttgctggaagcaaaa
cattctgctacaggacgtgcttttgatcccgttgaaaattttcatttgcgaaatggcgca
gaaatttatgctgtaaattggaaagctgatacaacaacaaagggaatggaaagtagttat
ggtgtgatggtgaattatctgtatcgattagatcaggttatgaaaaattcaactcagtat
attcaaaaaggagaaattgcaattaattctgacgctctagcgttattataa

DBGET integrated database retrieval system