KEGG   Brugia malayi (filaria): Bm1_53670Help
Entry
Bm1_53670         CDS       T01050                                 

Definition
Protein kinase domain containing protein
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
bmy  Brugia malayi (filaria)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    Bm1_53670
Enzymes [BR:bmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Bm1_53670
Protein kinases [BR:bmy01001]
 Serine/threonine protein kinases: Other group
  MOS family
   Bm1_53670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 383 aa AA seqDB search
MRKTRIKTWSETLCRSHFNHLIKLRNDSESPTRITACYPAKHIEKTTVYTVDNTLLEQSS
KIKLSVRCGALILSPLRLMRVFSERKQLYQKNKTKVIVTNETTASTNDKNNYRIGEGGFG
AVFRYVYNNRDVAIKQLHHCRHSSSSDFYSFCSELNAFRLPPSPYVVQAVAFTSSDICLQ
VVTEFIEGKNLQQLISDDKWNVTFLHRLQLAFQVISGLVHCHNHLLLHLDIKPANIIVHI
NGRTCKLSDFGCSKTATTSENGLLVVGDATVNAGFGTVAYKAPELLKGQEITDRADIYSF
SLLLWELLTRESICNSMHPHVFIYSVVVHKLRPKIEQLNIPKDKYGRALVTLLENCWSDE
LTRRPRAITAQQIIKKFVDSKKN
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaacgcgaataaagacgtggagtgaaacgctgtgtcgttcacacttcaatcac
ttgataaaattacgaaatgatagcgaatcgccaactagaataacagcatgttatcccgca
aagcatatagaaaaaacaacggtatatacggtagacaatacacttctggagcaatcatcg
aagataaagctaagtgttcgatgtggtgccttaattttaagtccattacgtttgatgcga
gtattttcggaaagaaaacaactttatcagaaaaataaaacgaaggtaattgttacaaat
gaaacgacagcttcaactaacgacaaaaacaattatcgaattggtgagggcggctttggg
gctgtatttcgatatgtgtacaacaaccgtgatgtagcgattaagcaattacatcactgt
cgacattcgtcatcttctgatttttattcgttttgctcagaactgaacgccttccgatta
ccgccatcaccatacgttgttcaggcggttgcgttcacgtcatccgacatttgtttacag
gttgtaacagaatttattgaagggaaaaacttgcaacaattgattagtgatgacaagtgg
aatgttacctttttgcatcgtctacagcttgcttttcaggtgataagtggtttagtgcat
tgtcataatcatttgttactacatttggatattaaaccagctaatattattgtacacata
aatggaaggacgtgtaaattatcagattttggttgctcaaaaactgcaacaacttcagaa
aatggcttattagttgttggtgatgcaacagtaaatgcaggatttggtaccgttgcttat
aaggcaccagaattattaaagggtcaagaaatcacagatagagctgatatctattctttt
tcattacttctatgggaacttctgacacgggaaagcatatgtaactccatgcatccacac
gtttttatctacagtgttgtcgtacacaaattaagacctaaaattgagcagttgaatata
ccgaaagataagtatggtagagccttagttacgctacttgaaaattgctggtcggatgaa
ttaacaagacgtccgcgtgctattacagcccaacaaatcatcaaaaaatttgttgactcc
aaaaaaaattaa

DBGET integrated database retrieval system