KEGG   Brugia malayi (filaria): Bm1_54855Help
Entry
Bm1_54855         CDS       T01050                                 

Definition
processing of precursor 7, ribonuclease P subunit, putative
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
bmy  Brugia malayi (filaria)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:bmy03013]
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:bmy03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 122 aa AA seqDB search
MTHIDEVEYELRKNLPPQFPKEKNDIYITRHTSIAAQKGRIIKLLDEKMDEVVLHGLGAA
VSRTINVALQIQRKLVDTVKIDVRTGTVKVTDNLFPLYDEVDFKTRNRFISAVHVRISRR
IM
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgacacatattgatgaggtagaatacgaactgcggaagaatcttccaccacaatttcca
aaagaaaaaaatgacatttatataacaaggcatacaagtatcgcagcacaaaaaggtcgg
ataattaaacttctggacgagaagatggatgaagttgtactacacggcttaggggcagca
gttagccggacgataaatgttgcattacaaatccagcgaaagttagtcgatacggtgaaa
atagatgtcagaactggtactgttaaggtcacagacaatttattcccactatacgacgaa
gtggattttaaaacacgaaatcgctttatttcagccgtacatgtacgaatatctcgacga
ataatgtaa

DBGET integrated database retrieval system