KEGG   Brugia malayi (filaria): Bm1_54855Help
Entry
Bm1_54855         CDS       T01050                                 

Definition
processing of precursor 7, ribonuclease P subunit, putative
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
bmy  Brugia malayi (filaria)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Bm1_54855
   03008 Ribosome biogenesis in eukaryotes
    Bm1_54855
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     Bm1_54855
Ribosome biogenesis [BR:bmy03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     Bm1_54855
Transfer RNA biogenesis [BR:bmy03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    Bm1_54855
Mitochondrial biogenesis [BR:bmy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    Bm1_54855
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 122 aa AA seqDB search
MTHIDEVEYELRKNLPPQFPKEKNDIYITRHTSIAAQKGRIIKLLDEKMDEVVLHGLGAA
VSRTINVALQIQRKLVDTVKIDVRTGTVKVTDNLFPLYDEVDFKTRNRFISAVHVRISRR
IM
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgacacatattgatgaggtagaatacgaactgcggaagaatcttccaccacaatttcca
aaagaaaaaaatgacatttatataacaaggcatacaagtatcgcagcacaaaaaggtcgg
ataattaaacttctggacgagaagatggatgaagttgtactacacggcttaggggcagca
gttagccggacgataaatgttgcattacaaatccagcgaaagttagtcgatacggtgaaa
atagatgtcagaactggtactgttaaggtcacagacaatttattcccactatacgacgaa
gtggattttaaaacacgaaatcgctttatttcagccgtacatgtacgaatatctcgacga
ataatgtaa

DBGET integrated database retrieval system