KEGG   Brugia malayi (filaria): Bm1_54930Help
Entry
Bm1_54930         CDS       T01050                                 

Definition
dihydrofolate reductase family protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bmy  Brugia malayi (filaria)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bm1_54930
   00670 One carbon pool by folate
    Bm1_54930
Enzymes [BR:bmy01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Bm1_54930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 172 aa AA seqDB search
MTRTLHMNLIVAVDGCGGIGRNGGMPWFLPAEMARFAKLTTLTMDSGKKNAVIMGRKVWE
SIPPKFRPLKNRFNVVLSRKIKEESNENVVVARSFESAISLLQDMENIETIWNIGGREMY
ITRVEGDFLADVFFPEVDYGRFIKSTESEEMHEEKGIKYRYEIYTVKIDKVA
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaccagaactctccatatgaatctgattgtggcagtggatggctgtggaggaatcgga
cgaaatggtggaatgccatggtttctacctgcagaaatggctcgatttgcaaagctgaca
acattaacaatggacagcgggaagaagaatgccgtgataatgggtcgaaaggtttgggaa
agcataccgccaaaatttaggccactgaagaatcgttttaatgttgtactcagtaggaag
ataaaagaagagtcaaatgagaatgtagtagtggctcgaagcttcgaaagtgcaattagc
ctactgcaagatatggaaaatattgagacgatatggaacattggtggtcgagaaatgtat
atcacccgtgtagagggcgatttcttggctgatgtcttctttcctgaagtagactatggt
cgtttcataaaaagtacagaatcggaagaaatgcacgaggaaaagggcattaaatatcga
tatgaaatatatactgttaaaatagataaagtcgcttga

DBGET integrated database retrieval system