KEGG   Brugia malayi (filaria): Bm1_55275Help
Entry
Bm1_55275         CDS       T01050                                 

Definition
Eif3s9 protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
bmy  Brugia malayi (filaria)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Bm1_55275
Translation factors [BR:bmy03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Bm1_55275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 642 aa AA seqDB search
GYCFVEYPGSEIAENATAILHGYLLDKNHTFSANLFNDLNKFEKPDEDWKPLEPRPYNNI
GDLWSWLQNEKCYDQFAVHYERDAQGSKYGSTSPFVGVYEYRKGQDPVPVTERHYWTETV
FRWSPNGTFFVSVHRMGIALWAGANFERFARYSHENVIMLDFSPCERFLVTYSLPENRWA
DDTNSLRIFDTMTGEMRRGFSLLTQEGSNELPCWPYFQWSADTRALGPDETYLACPEANG
FVACPKPGGNGINVYETRNFTLLDKKHVVIEGLRTFRWSPTRPILAYYCDERTSDNAPAE
IGLMEIPSKTKLRAQRIFSVSEAELFWNKNGDRLAAHTERYQKKNIKTSASGAVEEIKYT
NPTSHIEIFDARGKDISVLSMPLSESFIAFDWEPSGDKFCVLVGSQHKSTPLIYYLDTTK
HAPQLISKFEPMERFSDVLWAPAGGWLVVFSAGTASGNIMFIDSNGTRPTRTNLVEYPGF
NKGSWDPTGRYFTAACTIGGGKGDTGYRIYTFQGRELYRKPLDRLMQFKWRPRLSVKLPD
ETIKMIRKNLKTTSAKFEEEDKMERGRATKEVSEKRKKIMADFVQIRNICTKKLAEEAEL
RLQLRGGLDLLKTDNEDLVEETITVPLTTEKVKLQEATIPEE
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
ggctactgctttgtggaatatcctgggagcgagatagccgagaatgctacagcaatattg
catggttatctcctcgataaaaatcacacattttcggctaatctttttaatgatttgaat
aaattcgaaaaaccagatgaagattggaaaccattagaacctcgaccatataacaacatt
ggtgacttatggtcttggttacaaaatgagaaatgctacgatcaatttgctgtccattat
gagcgtgacgcacaaggctctaagtatggctcgacatcgccgtttgtcggagtttacgag
taccgaaaaggacaagatcctgtgcctgtcacggaacgacattattggactgaaacagta
tttaggtggtctcccaatggtactttctttgtaagtgttcatcgtatgggtattgcatta
tgggcaggagctaacttcgagcgttttgctcgttattcacatgaaaatgttataatgctc
gacttttcgccatgtgaaagatttcttgttacatattcattaccggagaatcgatgggct
gatgatactaactctttacgtatatttgacactatgactggcgaaatgcgacgtggtttt
tcgttgcttacccaagaaggatccaatgaattaccctgctggccatatttccaatggtca
gcagatactcgagctttgggaccggatgaaacatatttggcttgtccagaagcgaatgga
tttgtggcgtgtccgaaacctggtggtaatggaatcaatgtctatgaaacgaggaatttt
accttattagacaaaaagcatgtagtaattgagggtttacgaactttccgttggtcacca
acacgccccattcttgcatattattgtgacgaacgtacatcagataatgcaccagcggaa
attggtttaatggaaattccatcaaaaacgaaacttcgtgctcaacggatattttctgta
tcggaggcagaactgttttggaataagaacggtgatcgattagccgcacatacggaacgt
taccaaaagaaaaatatcaagacatctgcaagtggagctgtagaagaaattaagtataca
aatccgacttcacatatagaaattttcgatgcaagagggaaagatatctccgtgctttcg
atgcctctttccgaatcgtttatagcatttgactgggaaccatctggtgacaaattttgt
gtgcttgtcggatcacagcataaatcaactcctcttatatattatttggacacaaccaag
catgcgccccagctgatatcgaaattcgaaccaatggaacggttcagtgatgttctttgg
gcaccagctggtggttggcttgttgttttttccgctggtaccgcatcgggcaacataatg
tttattgatagcaacggaacgcgaccaactcgtaccaatttagttgaatatccaggcttc
aataagggaagttgggatcctacgggacggtattttacagcagcttgtacaattggtggt
ggaaaaggtgatacaggttatcgtatctacactttccaaggaagagaactgtacaggaaa
ccgctagatcggctgatgcagttcaaatggagaccacgtctatcggttaaattacctgat
gaaactattaagatgattaggaaaaatttgaagactacatcagccaaattcgaggaagaa
gataaaatggagcgtggaagggcaacgaaggaagtgagcgaaaaacgcaaaaaaattatg
gctgattttgtccagatccgtaatatctgcacgaagaaattggcagaagaagcagagcta
cgcttacaattgagaggtggcttagacttattgaaaacagacaatgaagacttagtggaa
gaaactataacggtacctttaactacagaaaaagtgaaattacaagaagcaacaatacct
gaagaatag

DBGET integrated database retrieval system