KEGG   Brugia malayi (filaria): Bm1_55680Help
Entry
Bm1_55680         CDS       T01050                                 

Definition
Phosphatidylinositol 3- and 4-kinase family protein
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
bmy  Brugia malayi (filaria)
Pathway
Inositol phosphate metabolism
ErbB signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Bm1_55680
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    Bm1_55680
   04630 Jak-STAT signaling pathway
    Bm1_55680
   04068 FoxO signaling pathway
    Bm1_55680
   04070 Phosphatidylinositol signaling system
    Bm1_55680
   04150 mTOR signaling pathway
    Bm1_55680
Enzymes [BR:bmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     Bm1_55680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 921 aa AA seqDB search
MSYRMDLYKVSEQAVSSRGVVGYSHYAFPEDVSSELDTDIPPQVKSKIQMADLYIELWYR
SREDELANIDTNCVCVKIRKVIGVHASDAIANAIKELMQQHKLFIKEAASSFLLQIAGRR
CFLTKDIRLTSFEYVRSSFENYRIPKFILRRKDIVMKDFTEPPPITKPGWVRAYESRLDR
TDGVAVKECSLWKVDDNLKLRIHSASHLSILDFDKIYVKASLYHGIDLIANRESACVSPS
NPRWSDGWIDFDVHLKDLAPSVQLCLSLVAVKQKKKEEYSGIGWVNIRLFDCDEKLIQGK
FMLYLWPFPKYCTELLYPSGQVGSNDNHDTVRIEVEFEDYGCVEFPDIDSMCEYVEKLDA
YGGKLRLQALSSPANSMKEFLDSLRFVDAEYLTDKQMEHLWEARELVAQYKPDLLPLIAH
CPLIWTRRDEFSRLYELLKRWGKIQPETALMLLDCKYPDIRIREFAVDSLDNVLDNDRLQ
LYILPLIQVLKFEPYGSCALSRMLLKRALCNNRIGHILFWLLRAELGQLSEVGQDLTKIY
KRFALMIEAYCRANYTHLNSMLRQVDMVVRLTNLSKIIKTMKDNECATKHLQKELASCVE
IMQNMISPLDVSNSLGALNIELCKVIGSAKQPLRLAWTNPEPLARLHNETHQIIFKNGDD
LRQDMLTLQVMRIMDALWKSQDYDLCLSIYEVLPMGRNVGMIYVVQNCSTLFEIQCAAKQ
LGSTFSMESGLINKYIRNYSENSKVYLEGVDRFTASCAGYCVATYVLGIKDRHQDNIMLA
KDGRLFHIDFGHFLGHYKKKLGINRDRVPFVLTDHFLCVIAKGKSNFRDSHEYKKFKKLC
TDAYIILHQRSKLFISLFSMLLCMGLPELQTREDIDFLKGTLCSDMDSALATTSFYKIFE
EAFSGAWSTKTNWFFHSVKHL
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatcgtatggatttgtataaagtgtcagaacaagcagtttctagtcgtggggtt
gtcggctattctcattatgcattccctgaagatgtttcaagcgagttagacactgatatt
ccgccacaagtcaaatcaaaaatccagatggcagatttgtacattgagttatggtatcgc
agtagagaggatgagctggcaaatatcgacacgaactgtgtttgtgtcaaaattcgtaaa
gttattggtgtgcatgcttcagatgctatagcaaatgcaataaaggagcttatgcaacaa
cataaattatttatcaaggaagctgcgtctagtttcttgttacaaatagcggggcggcgt
tgttttttaaccaaggacatcaggttaaccagttttgagtatgtcagatcatccttcgag
aattatcgcataccaaaattcatattgcgaagaaaagatattgtgatgaaagactttaca
gaacctccaccgataaccaaaccgggttgggtacgagcgtatgagagtcgactcgatcga
actgatggagtcgccgtgaaggaatgttctttgtggaaagtggatgataatttgaaatta
cgaatacacagcgcatctcatttaagcatattagattttgacaagatatatgtaaaagca
tctttatatcacggaatagatcttattgcaaatagagaatcagcctgtgtttctccttca
aatccgcgttggagtgatggctggatcgatttcgatgtacatttaaaagatttggctccg
tctgtacaattgtgcctttctctagttgccgtaaaacaaaaaaagaaagaggaatatagt
ggaattggttgggtgaatatacgccttttcgattgtgacgagaagctcattcagggaaaa
tttatgctttatttgtggccttttccgaagtattgcaccgagctactttatccatctgga
caagtaggatcaaatgacaatcatgatacagttcgtatagaagtagaatttgaagattat
ggatgtgtagaattcccagatatagattcaatgtgcgaatatgtcgaaaaactggatgct
tacggtggaaaattgcgtttacaagctttatcatcaccagccaattcaatgaaggaattt
cttgactccttacgttttgtggatgctgaatatttgaccgataagcaaatggaacattta
tgggaagcaagagagttagttgcacagtataaacctgatttattgccactaattgcgcat
tgtcccttgatttggacgagaagagacgaattttcacgactatacgaattactaaaacgg
tggggtaaaattcaaccagagacagctctgatgcttttggattgtaaatatcctgatatc
agaatccgagaatttgcagtagattcgcttgataatgttttggataatgatagattacag
ctttatatcttgcctctcattcaggttttgaagtttgagccgtatgggtcatgtgcttta
agcaggatgcttctgaaaagagctctgtgtaacaatcgcattggtcatatactgttttgg
ttactacgagctgaacttggacaactaagtgaagtaggtcaagatttaacaaagatttac
aaacgtttcgctttaatgattgaagcctattgtcgagctaactatactcatcttaattct
atgttacgacaagtggatatggtagtaaggttgacaaatcttagtaaaattatcaaaacc
atgaaggataatgaatgcgctaccaagcatttgcaaaaggaattggcatcatgcgtggaa
ataatgcagaatatgatctcacctttagatgtttccaatagtttaggcgcattaaacatt
gaactgtgtaaagtgatagggagtgcgaagcaaccactccgactggcctggactaatcca
gaacctcttgctcggttgcacaatgagacgcatcagattatcttcaagaacggtgatgat
ctgcgacaagatatgctaactctacaggttatgcgtattatggatgcactgtggaaaagt
caagattatgatctctgtttaagcatttatgaagtactgccaatgggaagaaatgttgga
atgatttatgttgttcaaaactgcagtacacttttcgaaattcagtgtgctgcaaagcag
cttggctcaacgttcagtatggaaagtggtcttattaacaaatatatacgaaattattcg
gaaaattcgaaagtatatctggaaggagttgatcgttttactgcttcgtgtgctggatac
tgtgttgcaacatatgtgttgggaatcaaggacagacatcaagataatatcatgctagcc
aaagatgggaggctgtttcatatcgattttggacattttttggggcactataaaaagaaa
ttaggtattaatcgtgatcgagtgccatttgttttgaccgatcattttctgtgcgttata
gccaagggcaaaagcaatttccgtgatagccacgaatataaaaagttcaagaagctatgt
acagatgcatatattatattgcatcaacgatccaagttatttatttcgctcttttcgatg
ctgctgtgtatggggcttcctgagctgcaaacgagagaagatattgatttcttgaaagga
acattatgctctgatatggattccgcccttgcaactacatcgttttacaaaatttttgaa
gaagcctttagcggcgcatggtcaactaaaactaattggttcttccattctgttaaacat
ttatag

DBGET integrated database retrieval system