KEGG   Bacillus mycoides ATCC 6462: BG05_1999Help
Entry
BG05_1999         CDS       T03798                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmyo  Bacillus mycoides ATCC 6462
Pathway
bmyo00071  Fatty acid degradation
bmyo00072  Synthesis and degradation of ketone bodies
bmyo00280  Valine, leucine and isoleucine degradation
bmyo00310  Lysine degradation
bmyo00362  Benzoate degradation
bmyo00380  Tryptophan metabolism
bmyo00620  Pyruvate metabolism
bmyo00630  Glyoxylate and dicarboxylate metabolism
bmyo00640  Propanoate metabolism
bmyo00650  Butanoate metabolism
bmyo00900  Terpenoid backbone biosynthesis
bmyo01100  Metabolic pathways
bmyo01110  Biosynthesis of secondary metabolites
bmyo01120  Microbial metabolism in diverse environments
bmyo01130  Biosynthesis of antibiotics
bmyo01200  Carbon metabolism
bmyo01212  Fatty acid metabolism
bmyo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmyo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BG05_1999 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    BG05_1999 (thlA)
   00640 Propanoate metabolism
    BG05_1999 (thlA)
   00650 Butanoate metabolism
    BG05_1999 (thlA)
  Lipid metabolism
   00071 Fatty acid degradation
    BG05_1999 (thlA)
   00072 Synthesis and degradation of ketone bodies
    BG05_1999 (thlA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BG05_1999 (thlA)
   00310 Lysine degradation
    BG05_1999 (thlA)
   00380 Tryptophan metabolism
    BG05_1999 (thlA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BG05_1999 (thlA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BG05_1999 (thlA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BG05_1999 (thlA)
Enzymes [BR:bmyo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BG05_1999 (thlA)
Exosome [BR:bmyo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BG05_1999 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AJH18044
UniProt: A0A0B5S9E0
Position
1885655..1886830
Genome map
AA seq 391 aa AA seqDB search
MHNVVITAAVRSPIGTFGGALKNITPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRT
DEANTARTAALAAGFPDTVTGYTIQRQCSSGMQAIMSAAMQIQLGVSDIVVAGGVEAMSS
SPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETAENLVEQYEITREEQDEVALR
SHTLALQAIESGHFDDQIVPISIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKDGSV
TAGNSSGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLE
KVEWSLEDADLLEINEAFAAQYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSL
IHELKRRGLEKGIASLCVGGGIGVALFIEAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgttgtcattacagctgcagttcgttcaccaattggaactttcggaggagca
ctaaaaaatataacaccagtagaattagctgttcctgtacttcaggaagctgtaaaaaga
ggcggagtagagccacatgaagttgatgaagtaattttaggtcattgtattcaaagaact
gatgaagcaaatacggcaagaacagctgcattagcggcaggatttcctgacacagttact
ggctatacaattcaacgtcaatgttcttcaggtatgcaagcaattatgtctgctgcaatg
caaatccaattaggtgtaagtgatattgttgttgcaggtggagtagaagcaatgagctcg
agcccttatgcattaaaacaacaccgttggggacaacgtctacagcacggagaaattcgt
gatacggtgtgggaagttttagaagatccgattcaccatattatgatgggtgaaacagcg
gaaaatttagttgaacaatatgaaattacaagagaggaacaagatgaagttgcgcttcgt
agtcatacattagcgttgcaagcaattgagtctggacactttgacgatcaaattgttcct
atttcgataaaagaacgtagaaaagaagttgtattttcgaaggatgaacatccacgtgca
gatattacagcggaaaaattagcaggattaaaaccagctttccgtaaagatggatcagta
actgcagggaattcatctggtcttaatgatggaagtgccgttttagtattaatgagtgaa
gaaaaggcgaaagaaaaaggtttacaaccgttagctcgaattgttggatattcagtagca
ggtgtagatccgaaaattatgggtattggaccagcaccagcaattcgcaaaggattagaa
aaagtagagtggtcattagaagatgcagacttacttgaaattaatgaagctttcgctgca
caatacctagctgtagagaaagagttagggttagaccgtgagaaagtgaatgtaaacggt
agtggggtaggacttggacatccaattggttgtacaggagctcgtattacggtaagttta
attcacgaattaaaaagacgtggattagagaaaggtattgcctctctatgcgttggaggc
ggtattggagtagctttatttatagaagcattataa

DBGET integrated database retrieval system