KEGG   Bacillus mycoides ATCC 6462: BG05_2404Help
Entry
BG05_2404         CDS       T03798                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmyo  Bacillus mycoides ATCC 6462
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:bmyo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BG05_2404
   00630 Glyoxylate and dicarboxylate metabolism
    BG05_2404
   00640 Propanoate metabolism
    BG05_2404
   00650 Butanoate metabolism
    BG05_2404
  Lipid metabolism
   00071 Fatty acid degradation
    BG05_2404
   00072 Synthesis and degradation of ketone bodies
    BG05_2404
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BG05_2404
   00310 Lysine degradation
    BG05_2404
   00380 Tryptophan metabolism
    BG05_2404
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BG05_2404
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BG05_2404
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BG05_2404
Enzymes [BR:bmyo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BG05_2404
Exosome [BR:bmyo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BG05_2404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2294608..2295705
Genome map
AA seq 365 aa AA seqDB search
MNRAVIVEAKRTPIGKKNGMLKDYEVQQLAAPLLTFLSKGIEREIDDVILGNVVGPGGNV
ARLSALEAGLGYHIPGVTIDRQCGAGLEAIRTACHFIQGDAGNCYIAGGVESTSTSPFQN
RARFSPETIGDPDMGLAAEYVAGQYNITKEIQDEYACLSYKRTLQALEKGYIQEEILPHY
FNGLLDESIKREMNYERMIKRTKPVFLQNGTVTAGNSCGVNDGACAVLVMEEGQAQKLGY
KPVLRFVRSAVVGVDPNLPGTGPIFAVNKLLNEMNMKVEDIDYFEINEAFASKIVACAKE
LQIPFEKLNVNGGAIALGHPYGASGAMLVTRLFYQAQREHMKYGITTLGIGGGIGLALLF
EKVEN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaatagggcggttattgtagaagcgaaaagaacacctattggtaaaaaaaacgggatg
ttgaaagattatgaagttcagcaattagcagcaccacttcttacgtttttaagtaaagga
attgagagagaaatagacgatgttatattagggaatgttgttggaccgggaggtaatgtt
gcaagattatctgctttagaagctgggcttggttatcatatacctggtgtaacgattgac
cggcaatgcggagctggattggaagcaattcgtactgcgtgtcattttattcaaggggat
gcaggtaattgttatattgctgggggcgtagagagtacaagtacgtcaccttttcaaaat
agagcgcggttttcacctgaaacaattggggatccagatatgggattggcggctgagtat
gttgcagggcaatataacataacaaaagagatacaagatgaatatgcttgtcttagctat
aaaagaacgctgcaagcattagaaaaaggatatatacaagaagagatattacctcattat
tttaatggattattagatgaatctataaagcgggaaatgaattatgaaagaatgattaag
agaacgaaacctgtatttttacaaaatggaacggtaacagcaggtaattcgtgcggtgta
aatgatggagcatgtgctgttcttgtaatggaagaggggcaagcacagaaattagggtac
aagccagttcttcgtttcgttcgtagtgctgtagttggcgtggatccaaatcttccaggg
actggtccgatatttgcggtgaacaaattattaaacgaaatgaatatgaaagtagaggac
atcgattattttgaaataaatgaagcatttgcttcaaaaattgttgcttgtgcaaaggag
ttacaaattccttttgaaaaattaaatgtaaatggtggagcaattgcgctcggtcatccg
tacggtgcatctggagctatgcttgtgacacgtttgttttatcaagcacaaagagagcat
atgaaatatggaattacgacgttaggaattggtggtggaatagggcttgcgctattattt
gagaaagtagaaaactag

DBGET integrated database retrieval system