KEGG   Brucella melitensis M28: BM28_A0040Help
Entry
BM28_A0040        CDS       T01852                                 

Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
bmz  Brucella melitensis M28
Pathway
bmz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmz00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BM28_A0040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ADZ65116
Position
1:44317..44895
Genome map
AA seq 192 aa AA seqDB search
MAFLATVFVVMTTGILSDSLFHSPAPEKPGFAIEVAQGSGGGESAAPPAKEEVSIATLLQ
SADPARGEVVFKRCQACHTGDKGGANKVGPHLWGVVGRPAASVEGFSYSAAMKEFGAAGN
KWDFEHLNKFLTSPKGFIKGTAMGFAGDKKDNERADLIAYLRTLSDNPVPLPAADAAPAD
SDKKPAEAAPAN
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcatttctggcaacggttttcgttgtcatgacgacgggcattctgtctgattcgctg
tttcattcgccggctcctgaaaagccgggctttgccatagaggtagcccaaggttcgggg
ggcggagaaagtgctgcgcctcccgccaaggaagaagtttcaattgcaaccctgttgcaa
agtgccgatccggcgcgtggcgaagtggttttcaagcgttgccaggcttgccacaccggg
gacaagggcggggccaacaaggttggtccgcatctgtggggtgtcgtgggtcgcccggct
gcctccgttgaaggtttcagctattccgctgccatgaaggaattcggcgcggctggcaac
aagtgggattttgagcatctcaacaagttcctcacctcgccgaaaggcttcatcaagggt
acagccatgggctttgccggtgacaagaaggataatgagcgcgctgacctgattgcttat
ctgcgcacgctgtccgacaatccggtgccgctgccggccgcagacgcagcgcccgcagat
agcgataaaaagcccgccgaagctgcaccggccaattga

DBGET integrated database retrieval system