KEGG   Brucella melitensis M28: BM28_A0213Help
Entry
BM28_A0213        CDS       T01852                                 

Definition
Zinc-containing alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bmz  Brucella melitensis M28
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bmz00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BM28_A0213
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BM28_A0213
  Lipid metabolism
   00071 Fatty acid degradation
    BM28_A0213
  Amino acid metabolism
   00350 Tyrosine metabolism
    BM28_A0213
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BM28_A0213
   00626 Naphthalene degradation
    BM28_A0213
Enzymes [BR:bmz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BM28_A0213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:215522..216556
Genome map
AA seq 344 aa AA seqDB search
MAKTMKAAVVRAFGKPLTIDEVPIPQPGPGQIQVAIQASGVCHTDLHAAEGDWPVKPNPP
FIPGHEGVGFVSAVGSGVKHVKEGDRVGIPWLYTACGHCRHCLGGWETLCEEQLNTGYSV
NGGFAEYVVADPNFVGHLPKNIDFNEIAPVLCAGVTVYKGLKVTDTKPGDWVVISGIGGL
GHMAVQYARAMGLNVAAVDIDDRKLDLARRLGATVTVNAKTVADPAAYIRKETDGGAQGV
LVTAVSPKAFEQALGMVARGGTVSLNGLPPGDFPLSIFNMVLNGVTVRGSIVGTRLDLQE
SLDFAADGKVKATIQTGKLEDINAIFDDMRQGNIEGRIVMDLTQ
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagacgatgaaagctgcggtcgtgcgtgccttcggcaaaccgctgacgattgat
gaagtgccgatacctcaacccggtcccggccagattcaggttgccattcaggcttccggc
gtatgccataccgaccttcatgccgccgagggcgattggccggtaaaacccaatccgccc
ttcattccgggtcatgagggtgtcggtttcgtttccgccgtgggcagcggcgtcaagcat
gtcaaggaaggcgaccgtgtcggcattccatggctttacactgcctgcggccattgccgc
cattgccttggtggctgggaaacgctttgcgaggaacagctcaataccggctattccgtc
aatggcggctttgccgaatatgtggtggccgatccgaatttcgtcggccacttgccgaag
aatatcgatttcaacgagattgcgccggtgctctgcgcgggcgtgacggtctataagggc
ctcaaggtcacggatacgaagcccggtgactgggtggtcatttcaggcataggcgggctc
ggccacatggctgtgcaatatgccagggccatggggctgaatgttgccgccgtcgatatt
gacgaccgcaagctcgatctcgcccgcagacttggcgcaaccgttacggtcaacgctaag
acggttgccgacccggcagcctatattcgcaaggaaaccgatggcggtgcgcaaggcgtg
ctggtgacggcggtttcgcccaaggcttttgaacaggcgctgggcatggttgcgcgcggc
ggtactgtttcgctgaatggcctgccgcctggcgatttcccgctttccatcttcaacatg
gtgctcaatggcgtaacggtgcgcggctccatcgtggggacgcggcttgatttgcaggaa
tcgctcgattttgcagccgacggcaaggtcaaggccaccatccaaaccggcaagctggaa
gacatcaacgccatcttcgacgatatgcggcaaggcaatatcgaaggccgcatcgtgatg
gacctgactcaatag

DBGET integrated database retrieval system