KEGG   Brucella melitensis M28: BM28_A0419Help
Entry
BM28_A0419        CDS       T01852                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bmz  Brucella melitensis M28
Pathway
bmz00900  Terpenoid backbone biosynthesis
bmz01100  Metabolic pathways
bmz01110  Biosynthesis of secondary metabolites
bmz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bmz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BM28_A0419 (ispE)
Enzymes [BR:bmz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BM28_A0419 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADZ65495
Position
1:complement(419286..420185)
Genome map
AA seq 299 aa AA seqDB search
MTTFQNAGPSITRLAPAKINLALHVTGRRDDGYHLLDMLVVFADQGDRIHIEKAGSDSFT
VSGPFASGIPAGRGNLVLKARDALRQHGGPDLSPVAIHLEKNLPIASGIGGGSSDAAATL
LALNTLWQLDLDFEMLAAIGLSLGADLPMCLHGAAHGTPLIARGIGEELNDVSGIAALPM
LLVNDGTALATPDVFRALTRRENAPLPPPACEGTDALCAYLRETRNDLLPAAISLAPQIE
PKLALLRAKGALYARMSGSGATCFAIFSDESALTRAAKEIADENPGWFAVPSHSFPSRA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacaacattccagaacgccggaccatcgataacgcgccttgcgcctgcaaagatcaat
ctggcgctgcatgtgaccgggcgacgtgacgacggctatcatcttctcgacatgctggtg
gtctttgccgatcagggcgatcgcatccacatcgaaaaagccggcagcgacagttttacg
gtcagcggcccttttgcaagcggcatccccgccgggcggggcaatctggtgctgaaagcg
cgcgatgcgctgcgccagcatggcgggccagacctttcacctgttgccattcatctggaa
aagaacctgcctattgcttccggcattggcggcggatcgagcgatgcggcagcaaccctg
cttgcgctcaacacgctctggcaactcgatctcgattttgaaatgctggccgctatcggc
ctttccctcggtgcagaccttcccatgtgcctgcatggcgcagcccatggcacaccgctg
atcgcgcgcggcattggtgaagagctgaacgatgtttccggaattgcggcccttcccatg
ctgctcgtcaatgacggtaccgcgcttgccacgcccgacgtgttccgcgcgctcacccgc
cgcgagaacgcccccctgccgcctccggcctgtgaagggacagacgccctttgcgcctat
ctgcgtgaaacacgcaatgatcttctgcccgcagccatcagccttgcaccgcagatcgaa
cccaaactcgccctgcttcgcgccaagggtgcactttatgcgcgaatgtccggctccggc
gcaacatgctttgccatttttagcgatgaatcagccctgacacgcgcggcaaaagagatt
gcggatgaaaatccgggctggtttgcagttccttcgcacagctttccttccagagcctga

DBGET integrated database retrieval system