KEGG   Brucella melitensis M28: BM28_A0798Help
Entry
BM28_A0798        CDS       T01852                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bmz  Brucella melitensis M28
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmz00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BM28_A0798 (speB)
Enzymes [BR:bmz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BM28_A0798 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(791349..792209)
Genome map
AA seq 286 aa AA seqDB search
MRRTYSKSLKGAEAVVWGIPFDAAVSNRPGARFGPQAIRRASAIFDNDPQYPFERDLFEN
LAVIDYGDCLLNYGNHTKTPSTIEREAAKILKSDAFLLTLGGDHFITWPLLKAHAAKYGP
LALVQFDAHQDTWFDDGRRIDHGSFVARTARDGIIDPDLSIQIGIRTHAPEDCGIRIIYG
HEVEDMPAAAIADAILKRTNGRKAYLTFDIDCLDPAFAPGTGTPVAGGPSSAKMLSVLRK
LTALDFVGADVVEVAPAYDHADITAIAGATIAMYYLGLLGERKERR
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcacttactccaagtcgctcaaaggcgcggaagcagttgtctggggcattcct
ttcgatgccgccgtttccaaccggcccggcgcacgcttcggcccgcaggcgatccggcgc
gcctcggcgatcttcgacaacgatccgcaatatccgttcgagcgtgatcttttcgagaat
ctcgctgtcatcgattatggcgactgcctgctcaactatggcaatcacaccaagacaccc
tccaccatcgagcgtgaagcagcaaaaatcctgaaatccgatgcatttctgctgacgctc
ggcggcgatcatttcatcacatggccgcttctcaaggcccatgccgcaaaatacggcccc
ctcgctctggtgcagttcgatgcgcatcaggatacatggttcgatgatggcaggcggatc
gaccacggctccttcgtggcccgcacggcgcgcgacggcatcatcgatcccgacctttcg
atccagattggcatccgcacgcatgcgccggaagattgcggcatcaggatcatttatggc
cacgaggtcgaggatatgccagcggcggcgattgccgatgcaatcctgaaacgcaccaat
ggcaggaaagcctatctgaccttcgacattgactgtcttgatccggcttttgcgccggga
accggcacgccggttgcaggcggcccctcctcggcaaagatgctgtctgtcctgcgcaag
ctgacggctcttgacttcgtgggcgccgatgtagtcgaggttgcaccggcctatgaccat
gccgatataacagccatcgcgggagcgacgatcgcaatgtattatctgggccttctgggc
gaacggaaagaacgacgatga

DBGET integrated database retrieval system