KEGG   Brucella melitensis M28: BM28_A1135Help
Entry
BM28_A1135        CDS       T01852                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bmz  Brucella melitensis M28
Pathway
bmz00010  Glycolysis / Gluconeogenesis
bmz00020  Citrate cycle (TCA cycle)
bmz00620  Pyruvate metabolism
bmz01100  Metabolic pathways
bmz01110  Biosynthesis of secondary metabolites
bmz01120  Microbial metabolism in diverse environments
bmz01130  Biosynthesis of antibiotics
bmz01200  Carbon metabolism
Module
bmz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bmz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BM28_A1135
   00020 Citrate cycle (TCA cycle)
    BM28_A1135
   00620 Pyruvate metabolism
    BM28_A1135
Enzymes [BR:bmz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BM28_A1135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Peptidase_M23 QRPTase_N ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: ADZ66211
Position
1:complement(1123404..1124747)
Genome map
AA seq 447 aa AA seqDB search
MPINITMPALSPTMEEGNLSKWLVKEGDKVAPGDVIAEIETDKATMEVEAVDEGTVAKIV
VPAGTEGVKVNALIAVLAEEGEDVAAAAKGAGAAPKAEAPKEEPKPAEAKKEAAAPAAAP
APARSEQPAVAPAVNKGERVFASPLARRIAKDAGVDISAVKGSGPHGHVIQRDVEAALAS
GGAKAVSAQAESAAAPKPMSDDAILKLFEDGSYEVVPHDGMRKTIARRLVESKQTVPHFY
LTIDCELDALLALRSQINAAAPMLKTEKGEVPAYKLSVNDMVIKATALALRDVPEANVSW
TEGGMIKHKCSDVGVAVSIPGGLITPIVRHAESKTLSVISNEMKDMARRARDRKLKPEEY
QGGSTSVSNLGMFGVKDFAAIINPPHATIFAIGAGEERAVVKKGEIKVATVMSVTLSTDH
RAVDGALAAELAQAFKRHIENPMGMLV
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaatatcaccatgccagcgctttctcccacgatggaagaaggtaacctgtcg
aaatggctggtcaaggaaggcgataaggtcgctcccggcgatgttattgccgaaatcgaa
accgacaaggccacgatggaagtcgaggcggtggacgagggaacggtcgccaagatcgtc
gttccggctggcactgaaggcgtcaaggttaatgcgctgatcgctgttcttgccgaagaa
ggtgaggatgtggcggctgcggccaagggcgctggcgcggctcccaaggcagaagcgccg
aaggaagagccgaagcctgctgaagcgaaaaaggaagctgcggctcctgccgctgcaccg
gctccagccaggagcgagcagcctgctgttgcgcctgccgtaaacaagggcgagcgcgtg
ttcgcctcaccgcttgcgcgccgtatcgccaaggatgcaggcgtcgatatttctgccgtg
aagggctccggcccgcatggccacgtgattcagcgcgatgtggaagctgctctggcttcc
ggcggtgccaaggccgtttcggcacaggccgaatctgctgccgcgccgaagccgatgtcg
gatgatgccattctcaaactcttcgaggacggctcctacgaggtcgtgccgcatgacggt
atgcgcaagacaattgcccgccgtctggtggaatcgaagcagactgttccgcatttctat
ctgacgatcgattgcgaactggatgcgcttctggcgctgcgttcgcagatcaatgctgcg
gccccgatgctcaagacggaaaagggcgaggttccggcctacaagctttccgtcaacgac
atggttatcaaggcgacggcgctggcgctgcgtgacgtgccggaggcgaatgtttcctgg
accgagggcggcatgatcaagcacaagtgttcggatgtgggggttgccgtttccattccg
ggcggcctgattacgcctatcgtccgccacgcggaatcgaagacgctctccgttatctcg
aacgagatgaaggatatggccagacgcgcgcgtgaccgcaagctgaagcctgaggaatat
cagggtggctcgacctccgtgtcaaacctcggcatgttcggcgtcaaggatttcgccgcg
atcatcaatccgccacatgcaaccattttcgcaattggtgcaggcgaggagcgcgccgtg
gtcaagaagggggaaataaaggtagcgactgtcatgtctgttacactttccaccgatcat
cgcgctgtcgatggtgcgcttgccgcagaacttgcgcaggcattcaagcgccatatcgaa
aacccgatgggtatgctggtctga

DBGET integrated database retrieval system