KEGG   Brucella melitensis M28: BM28_A1209Help
Entry
BM28_A1209        CDS       T01852                                 

Gene name
phoA
Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bmz  Brucella melitensis M28
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bmz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BM28_A1209 (phoA)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BM28_A1209 (phoA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BM28_A1209 (phoA)
Enzymes [BR:bmz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BM28_A1209 (phoA)
Exosome [BR:bmz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BM28_A1209 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1195392..1196759
Genome map
AA seq 455 aa AA seqDB search
MAQSETAAPLFQRSAKGDLSAAGGARRLDGDITAAFRDQIRKGPARNVILLIGDGMGDSE
ITVARNYAVGAGNHFKGIDALPVTGQYTHYSLDKESGKPNYVTDSAASGTAWATGVKTYN
GAIGVDIHGKPHKTLIELAKEKGLGTGNVSTAELQDATPAVQVAHVTHRKCYDPTSTAEK
CKDNALENGGPGSISEQLLNTRPDVTLGGGAKYFEDKARAGTWKGQTLSAQAEARGYQLV
RNADALSKVETANQDKPVLGLFSPGNMPVRWKGPQAAHHGNLDREPVKCKVNEKRTADIP
TLAQMTEKAIDLLKTNEKGFFLQVEGASIDKQDHAANPCGQIGETVDLDEAVQAALDFAR
KDGNTLVIVTADHAHASQIIDPDAKAPGLSQALKTEDGAIMGVTYGNSDEADDQGHTGAQ
LRIAAFGPGAANFTGLTDQTDMFYTIRDALQLQAE
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcccagtctgaaactgcggctccactcttccagcgcagcgcaaaaggcgacctgtcg
gcagcaggcggcgcacgccgccttgatggtgatattaccgcagcttttcgcgatcagatc
aggaaggggcctgccagaaacgtcatcctgctgatcggagacggcatgggcgattccgag
atcacggttgcgcgcaattatgcagtcggcgcaggcaatcatttcaagggcatcgatgcc
cttcccgttaccggccagtacacccattattcgctcgacaaggaaagcggcaagccaaat
tacgtgactgattctgccgcctccggcaccgcctgggccactggcgtcaaaacctataac
ggcgccatcggcgtcgatattcatggcaaaccgcacaaaacgctcattgaactcgccaag
gaaaagggcctcggcaccggcaatgtcagcactgccgaattgcaggatgccacacccgcc
gtgcaggttgcccatgttacccatcgcaagtgctacgacccaaccagcacggcggaaaag
tgcaaggataatgcgcttgaaaatggcggcccaggctcgatcagcgaacagcttttgaac
acccgcccggacgtgacattgggcggcggcgcaaaatatttcgaggacaaggcccgggct
ggcacatggaaaggccagaccttgagcgcacaggccgaagcacgcggctatcaactggtt
agaaatgccgacgcattgagcaaggtcgagacagccaatcaggacaaacctgttctcggc
ctcttctcaccgggcaacatgccggtccgctggaaagggcctcaggccgcccatcacggc
aatctcgacagagagcctgtcaagtgcaaggtcaatgagaagcgcactgccgatattccg
acactggcgcaaatgaccgagaaagccatcgacctgctgaaaaccaacgaaaaaggcttt
ttccttcaggtggaaggtgcctccatcgacaaacaggaccatgccgccaatccgtgcggg
cagatcggcgaaacagtcgatctggatgaagccgtgcaggccgcactcgattttgcccgc
aaagacggcaacacgcttgtcatcgtaacggccgatcacgcccatgcaagccagatcatt
gatcccgatgcgaaggctccgggtttgagccaggcattgaaaaccgaggatggcgcgatc
atgggcgtgacctatggcaattccgacgaagccgacgatcagggccacacaggcgcgcaa
ttgcgcatagccgcctttggccccggcgctgccaattttaccggcctcacggatcagacg
gatatgttctacacgatccgcgatgccttgcagttgcaggcggaataa

DBGET integrated database retrieval system