KEGG   Brucella melitensis M28: BM28_A1619Help
Entry
BM28_A1619        CDS       T01852                                 

Gene name
aceA
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bmz  Brucella melitensis M28
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bmz01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bmz00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1:1582564..1583853
Genome map
AA seq 429 aa AA seqDB search
MTDFYSLIPSAPKGRFDGIERAHTAEDVKRLRGSVEIKYSLAEMGANRLWKLIHEEDFVN
ALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAGPELAKRINRT
LQRADQIETAEGKGLSVDTWFAPIVADAEAGFGDPLDAFEIMKAYIEAGAAGVHFEDQLA
SEKKCGHLGGKVLIPTAAHIRNLNAARLAADVMGTPTLIVARTDAEAAKLLTSDIDERDQ
PFVDYEAGRTAEGFYQVKNGIEPCIARAIAYAPYCDLIWMETSKPDLAQARRFAEAVHKA
HPGKLLAYNCSPSFNWKKNLDDATIAKFQRELGAMGYKFQFITLAGFHQLNYGMFELARG
YKDRQMAAYSELQQAEFAAEADGYTATKHQREVGTGYFDAVSLAITGGQSSTTAMKESTE
TAQFKPAAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacagatttttacagcctcatcccttcggcacccaagggccgcttcgacggcattgaa
cgtgcgcatacggccgaagacgtgaaaaggctgcgcggttcggtggagataaagtattcg
ctggccgaaatgggtgcaaaccgcctctggaagctgatccacgaggaagatttcgtcaat
gcgctgggcgcgctttccggcaaccaggccatgcagatggttcgcgccgggttgaaggcg
atctacctttccggctggcaggttgcagcagacgccaacacggcatcagccatgtatccc
gaccagtcgctctatccggccaatgccgggccagagcttgcaaagcgcatcaaccgcacg
ctgcaacgcgccgaccagatcgaaaccgccgaaggcaaggggctttcggttgacacatgg
ttcgcgcccatcgtggcggatgccgaggcaggctttggcgacccgctggatgccttcgag
atcatgaaagcctatatcgaggccggtgctgcgggcgttcactttgaagaccagcttgct
tcggaaaagaagtgcggccatctgggcggcaaggttctgatcccgaccgcagcgcacatc
cgcaacctcaacgcggcacgccttgcagccgacgtcatgggcacgccgaccctcatcgtg
gcgcgcacggatgcggaagcagccaagcttctgacgtcggatatcgacgagcgcgaccag
cctttcgtcgattacgaagcaggccgcacggcggaaggcttctatcaggtgaagaatggc
atcgagccatgcatcgcccgtgcgattgcctatgcgccttattgcgatctgatctggatg
gaaacgtccaagcctgatctcgcacaggcccgtcgcttcgcggaagccgtgcacaaggcg
catccgggcaagctgctcgcctataactgctcgccgtcgttcaactggaaaaagaacctc
gacgacgcgacgattgccaagttccagcgcgagctgggcgcgatgggctacaagttccag
ttcatcacgctggctggcttccaccagctcaactacggcatgttcgagctggcacgcggc
tacaaggatcgtcagatggcggcttattccgagctgcaacaggcggaatttgcagccgaa
gccgatggctacacggcaaccaagcaccagcgcgaagtcggcaccggctatttcgatgcc
gtgtcgctcgcaatcaccggcggccagtcttcgaccaccgccatgaaggaatcgaccgaa
accgcacagttcaagccggctgccgagtag

DBGET integrated database retrieval system