KEGG   Brucella melitensis M28: BM28_A1705Help
Entry
BM28_A1705        CDS       T01852                                 

Gene name
ruvA
Definition
Bacterial DNA recombination protein, RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bmz  Brucella melitensis M28
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bmz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BM28_A1705 (ruvA)
Enzymes [BR:bmz01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BM28_A1705 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1665953..1666570)
Genome map
AA seq 205 aa AA seqDB search
MIGKLKGVIDEIAEDHAVIDVHGVGYVAFCSARTLGNLGGAGEAAILFIETYVREDMIRL
YGFATQLEREWFRLLQNVQGVGAKVALAVLGTLSPSELANAIALRDIAMVSRAPGVGKKV
AERIVTELKNKAPAFAGEASGTIGLKQELGAGAAPAPVADAVSALSNLGYSRDQAANAVA
AALKETGEGADSAKLIRLGLKELSQ
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaagttgaagggcgtgattgacgaaattgccgaggaccatgctgtcatcgac
gtgcatggcgtgggctatgtcgcgttttgttcggcgcgcacgctgggcaatctcggtggc
gcgggcgaggcggccatcctgttcatcgaaacctatgtccgtgaagatatgatccgcctt
tatggatttgccacgcagcttgagcgcgaatggttccgcctgttgcagaatgtgcaaggg
gtgggggccaaggtggctttggcggtgcttggcaccctgtcgccgtccgaacttgccaat
gcgattgcgctgcgcgacattgccatggtttcgcgcgcgccgggcgtcggcaagaaagtg
gcagagcgtatcgttaccgaattgaagaacaaggctcccgcctttgccggtgaggcgagc
ggcacgatcgggctcaagcaggagcttggcgcaggtgcggcgcctgcacccgttgccgat
gcggtttcggcgctttccaacctcggttattcgcgcgatcaggccgccaatgccgtggca
gccgccttgaaggaaacgggcgagggcgccgattcggccaagctgatacggctcggtttg
aaggaactctcgcagtga

DBGET integrated database retrieval system