KEGG   Brucella melitensis M28: BM28_A1774Help
Entry
BM28_A1774        CDS       T01852                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bmz  Brucella melitensis M28
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bmz00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bmz00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1726884..1727675
Genome map
AA seq 263 aa AA seqDB search
MTDVSARKTAIVTGSNSGIGLGIAHALAAAGHNVVINSFTDRDEDHALARMLAEEHGANV
IYIAADMSKAEDCRNLIAKTVKVFGNSDILVNNAGIQHVAPVEEFPPEQWDRIIAINLTS
AFHTSAAAIPHMLKAGWGRIINIASAHGLVASPFKSAYVAAKHGIVGFTKTLALELATAK
ITANSICPGYVLTPLVEAQIPDQMKAHHMDRETVIRDVMLDKQPTKEFVTTAQIGAVATF
LASDAAAQINGAAISVDGGWTAE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgtatccgcccgcaaaactgcaattgttaccggatcaaattcagggatcggc
ctcggaatcgcccatgcactggcagccgcggggcataacgtcgtaataaactccttcacc
gaccgggacgaagaccatgcgcttgcccggatgcttgccgaagaacatggtgcgaatgtc
atctatattgccgcggatatgtcgaaagccgaagattgccgcaatctcattgccaaaacc
gtcaaggttttcggcaactccgatattctggtcaataatgcgggcatccagcatgtcgcc
ccggtggaagagtttcctcccgagcaatgggaccgcatcatcgcaatcaacctgacatcg
gccttccacacttctgctgctgccatcccccatatgctaaaggcgggctggggccgtatc
atcaatattgcctcggcgcatggtctcgtggcttcgccgttcaaatcggcatatgtcgcc
gccaagcacggcattgtcggcttcaccaagacgctggcgctggagcttgccaccgcaaaa
atcaccgccaattccatctgtcccggctatgtgctgacccctctggtggaagcgcagata
cccgaccagatgaaagcccaccacatggaccgtgaaaccgtgatccgcgacgtgatgctg
gataaacagccgacgaaggagtttgtcaccaccgcgcaaatcggggccgttgccactttc
ctcgcaagcgatgcggcagcgcagatcaacggtgcagccatttccgtcgacggcggctgg
acggcagaataa

DBGET integrated database retrieval system