KEGG   Brucella melitensis M28: BM28_A1875Help
Entry
BM28_A1875        CDS       T01852                                 

Definition
Uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bmz  Brucella melitensis M28
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BM28_A1875
Enzymes [BR:bmz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BM28_A1875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1839381..1840088)
Genome map
AA seq 235 aa AA seqDB search
MKRVLVTRPEPAAAQTAAKLRAAGYEPVLLPLSRTVALSFTVPDEVFDALTITSANAFRH
IAPERLLPYRTLPLFAVGEGTAKAAQEAGFKHVIEGGGDAVRLAGTMRQALAPTARVLYL
AGRVRQPVFEDEVAANGLSMMVCDVYDTESVMYPPQALSRILGHAPFVAVMLYSGVAAAS
FVEAMRSITPPFDEKTRFLCISARVAAKLPSSWLQQALVSDHPDEKGLFRLFSKL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgggttcttgttacacggcctgagccggcagcagcgcaaaccgcagcaaagctt
cgcgcggcgggctatgagccagtgcttctgccgttgagccgcaccgtggcgctttccttt
accgttcccgatgaagttttcgacgcgctcaccattacgagcgccaatgcctttcgccat
attgcgccggagcggcttttgccctaccgcacgctgccgctttttgctgtgggtgagggg
acagcgaaggctgcgcaggaggccggttttaaacatgtgatcgagggtgggggcgatgcc
gttcgccttgccgggaccatgcggcaggcgctggcgccaactgcgcgcgtcctttatctt
gccgggcgggttcgccagccggtttttgaagatgaggtggcggcaaatggtctttcaatg
atggtttgcgatgtctacgacactgagtcggtcatgtatccgccgcaggcgctttcccgc
attctcggccatgcgccatttgtcgcggtgatgctttattcaggcgtggcggcggccagt
tttgtcgaagcgatgcgctccattacgccgccattcgatgagaagacgcggtttttatgc
atttcggcgcgggttgcggccaaattgccttccagttggctgcaacaggcgctggtttcg
gatcatccagatgaaaaggggcttttccgcttgttttctaaactttga

DBGET integrated database retrieval system