KEGG   Brucella melitensis M28: BM28_A2171Help
Entry
BM28_A2171        CDS       T01852                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bmz  Brucella melitensis M28
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bmz03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2123544..2124425
Genome map
AA seq 293 aa AA seqDB search
MPELPEVETVRRGLQPFMEGATVVRVEQNRPDLRFAFPENFAERLSGRRIEALGRRAKYL
TVHLDDGLSIISHLGMSGSFRIEAEDAQGLPGGFHHERSKNSLHDHVVFHLMRPDGASAR
IIYNDPRRFGFMLFAEKGALEEHPLLKDLGVEPTGNLLSGEVLAALFKGRRTPLKAALLD
QRLIAGLGNIYVCEALWRPGLSPMRAAGSVAGEMDVMERLAGAIRSVIAQAIAAGGSSLK
DYIQADGALGYFQHSFSVYGREGKPCRNPACGGTVERVVQSGRSTFFCASCQT
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgccggaactgccagaggtcgaaacggttcgccgtggtctgcaacccttcatggaaggg
gcaaccgttgtgcgggtggagcagaatcggcccgacctgcgctttgcctttcctgaaaat
tttgccgaacgcctttccggcaggcgcatcgaggcgcttggccgccgtgcgaaatatctg
accgtccatctcgatgacgggctttcgatcatcagccatctcggcatgtccggctcgttt
cgcattgaggcggaggatgcgcaaggtttgccgggcgggtttcatcacgagcgctccaag
aacagcctgcatgaccatgtggtctttcacctcatgcgcccggacggtgcgtctgcacgc
attatttataatgatccgcgccgcttcggtttcatgctctttgccgaaaagggcgcgctg
gaggaacatccgctcctgaaagaccttggtgtggagccgaccggcaatctcctgtcgggc
gaggttctggccgcgcttttcaagggacgccgcacgcccctgaaggccgccttgctcgac
cagaggcttatcgcggggcttggcaatatctatgtctgcgaggcgctctggcgcccaggg
ctttcgccgatgcgcgcggcaggctcggttgcaggcgaaatggacgtgatggagcggctt
gccggggccattcgctccgtcattgcgcaggcgattgcagccggaggctccagccttaag
gattacattcaggccgacggtgcgctcggctatttccagcactctttttccgtctatggc
cgcgagggtaagccatgcagaaaccccgcctgcggcggcactgtcgagcgcgtggtgcaa
tctggtcgttcgacttttttctgtgcctcttgccagacatga

DBGET integrated database retrieval system