KEGG   Brucella melitensis M28: BM28_B0049Help
Entry
BM28_B0049        CDS       T01852                                 

Definition
Alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bmz  Brucella melitensis M28
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bmz00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BM28_B0049
Enzymes [BR:bmz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BM28_B0049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(42215..43210)
Genome map
AA seq 331 aa AA seqDB search
MSELLFETDANPIPSRIRGGLFHAPDGKALRYALLKAESRPCRGTVIVLQGRNEFIENYY
ETMSDLAGRGFTVATFDWRGQGGSHRLLRDRLRGYVRSFNDYADDLDHFLTGIVLPDCPP
PFFILAHSAGALVALSSLERLSSRITRMVLCAPLMGLGGQKISDDNVRRITAALRWIGLG
RIYAAGGRTLSAARAFADNPLTSDPLRFMRNVEITRTYTDLALGGPTVRWVWSALETAWR
INQPDFYKSPIAPVLIIAAGADRVVSTAVIERFVARTRNISLAVIDGARHEMLQEADFYR
EQVLAAFDAFIPGSSPVESMPQSLEPDLSQI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaactgctttttgaaaccgatgcaaatccgatcccgagccgaataagaggcggt
cttttccatgcgccggacgggaaggccctgcgctacgccctgctgaaagccgaaagccgg
ccgtgccggggcacggtcatcgtgcttcagggccgcaacgaattcatcgaaaattattat
gaaaccatgtccgacctcgccgggcgcggttttaccgttgccaccttcgactggcgcggc
cagggcggctcgcatcgcctgctgcgcgaccgcctgcgcggctatgtgcgcagcttcaac
gattatgccgacgatctcgaccatttcctgaccggaatcgtgctgcccgactgcccgccg
ccatttttcattctcgctcactcggcaggtgcgctggtcgcgctttcctcactggaacgg
ctctcctcccgcatcacccgcatggtgctttgcgcgcccctgatggggcttggcggacag
aaaatcagcgatgacaatgtgcgccgcattaccgccgcgctgcgctggatcggcctgggg
agaatctatgcggcaggcgggcgcaccctgtcggcggcgcgcgcctttgccgacaatcca
ctgaccagtgatccgttacggttcatgcgcaatgtggaaatcacacggacttatacggac
ctcgcgcttggcggccccaccgtgcgctgggtctggagcgcactggaaaccgcatggcgc
atcaaccagccggatttttacaaaagccccatcgcgccggttctgattatcgcggctggt
gctgaccgcgttgtttcaacagcggtgatcgagcgtttcgtggcgcgcacgcgaaacatc
tcgctcgccgttattgacggtgcgcgccacgaaatgctccaggaagcagatttctaccgc
gaacaggtgctggcggctttcgacgccttcatccccggctcatcgccggtggaatccatg
ccccaaagtcttgaacccgacctctctcaaatctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system