KEGG   Brucella melitensis M28: BM28_B0169Help
Entry
BM28_B0169        CDS       T01852                                 

Gene name
cycA
Definition
Cytochrome c heme-binding site
Orthology
K08738  
cytochrome c
Organism
bmz  Brucella melitensis M28
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bmz00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BM28_B0169 (cycA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BM28_B0169 (cycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:159506..159952
Genome map
AA seq 148 aa AA seqDB search
MSDYGLGRPNKTKEFSNMRAAMTAISAIAASLLISTVAQGADIESGKKIFNACKACHQIG
EGAKNMVGPELNGLFGRHSGSVEGYKYSDANKNSGIVWDEEIFRKYIKKPREVIPKTKMV
YAGLKDEGKIDDLIAFLKQYDLGGKIKE
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgattatgggctgggccgccccaataaaaccaaggagttcagcaatatgcgtgct
gcaatgaccgcgatttccgcaatcgcagcttcccttttgatctcgactgtcgcgcaaggg
gcggatatcgaatccggcaagaagattttcaacgcatgcaaggcttgccatcagattggt
gagggggcgaaaaatatggtcggccctgagctcaacgggctctttgggcgtcactcgggt
tccgtcgaaggatataagtattccgacgcaaacaagaattccggaattgtctgggatgag
gaaattttccgcaaatacatcaagaagccgcgtgaagtgatcccgaagaccaagatggtc
tatgctggcttgaaggatgagggaaagatcgacgacctgattgcatttctcaagcagtat
gatctgggcggcaagatcaaggaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system