KEGG   Brucella melitensis M28: BM28_B0419Help
Entry
BM28_B0419        CDS       T01852                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bmz  Brucella melitensis M28
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmz00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BM28_B0419
Enzymes [BR:bmz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BM28_B0419
Exosome [BR:bmz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BM28_B0419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(412909..413076)
Genome map
AA seq 55 aa AA seqDB search
MSGYILAIDQGTTSTRSMLFDRNMRVVGLGQQEFTQHFPSSGWVEHDAEEIWKSV
NT seq 168 nt NT seq  +upstreamnt  +downstreamnt
atgagcggatatattctggctatcgatcagggaaccacctccacaaggtcgatgctgttc
gacaggaatatgcgggtcgtggggttggggcagcaggaatttacgcagcattttccttcc
tccggctgggtggagcacgatgcggaagaaatctggaaatcggtgtag

DBGET integrated database retrieval system