KEGG   Brucella melitensis M28: BM28_B0425Help
Entry
BM28_B0425        CDS       T01852                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmz  Brucella melitensis M28
Pathway
bmz00071  Fatty acid degradation
bmz00072  Synthesis and degradation of ketone bodies
bmz00280  Valine, leucine and isoleucine degradation
bmz00310  Lysine degradation
bmz00362  Benzoate degradation
bmz00380  Tryptophan metabolism
bmz00620  Pyruvate metabolism
bmz00630  Glyoxylate and dicarboxylate metabolism
bmz00640  Propanoate metabolism
bmz00650  Butanoate metabolism
bmz00900  Terpenoid backbone biosynthesis
bmz01100  Metabolic pathways
bmz01110  Biosynthesis of secondary metabolites
bmz01120  Microbial metabolism in diverse environments
bmz01130  Biosynthesis of antibiotics
bmz01200  Carbon metabolism
bmz01212  Fatty acid metabolism
bmz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BM28_B0425
   00630 Glyoxylate and dicarboxylate metabolism
    BM28_B0425
   00640 Propanoate metabolism
    BM28_B0425
   00650 Butanoate metabolism
    BM28_B0425
  Lipid metabolism
   00071 Fatty acid degradation
    BM28_B0425
   00072 Synthesis and degradation of ketone bodies
    BM28_B0425
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BM28_B0425
   00310 Lysine degradation
    BM28_B0425
   00380 Tryptophan metabolism
    BM28_B0425
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BM28_B0425
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BM28_B0425
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BM28_B0425
Enzymes [BR:bmz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BM28_B0425
Exosome [BR:bmz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BM28_B0425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADZ67674
Position
2:complement(417147..418337)
Genome map
AA seq 396 aa AA seqDB search
MSKSDPIVIVGASRTPMGGFQGDFTNAQATDLGASAIGGALAGAGLAPEAVEEVIMGCVL
PAGQGQAPARQASLKAGLPLGTGATTVNKMCGSGMKAAMLAHDLILAGSADVIVAGGMES
MTNAPYLLPKARGGYRMGHGQVLDHMFLDGLEDAYDKGRLMGTFAEDCAEAYQFTREAQD
AFAISSLTRAQNAIKDGLFAAEITPVKVKSGRAEVEVTIDEQPGKAKLDKIPTLRPAFRE
GGTVTAANSSSISDGAAALLLMRASEAEKRGLTPRAVITGHATYADKPNLFSTAPIGAIR
KLSEKTGWDLKDVDLFEINEAFAVVAMAAVRDLDLPHDKVNIHGGACALGHPIGASGARI
LVTLLAALETHGLKRGIAGICLGGGEATAMGIERII
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagagcgatcctattgtcatcgtcggtgcttcgcgcacccccatgggcggtttt
cagggtgacttcacaaatgcgcaggcaaccgaccttggcgcttccgccatcggcggcgcg
cttgccggtgcaggccttgccccggaagccgtcgaggaggttatcatgggctgtgtcctg
cctgctggtcagggtcaggcgcctgcgcgtcaggcctcgctcaaggccgggctgccgctt
ggcaccggtgccacgaccgtcaacaagatgtgcggctcgggcatgaaggccgcgatgctt
gcccatgacctcatccttgccggttccgccgatgtcatcgtcgcgggcggcatggaaagc
atgacaaatgccccctatcttctgcccaaggcgcgcgggggctatcgcatgggccatgga
caggtgctcgaccatatgttcctcgatgggctggaagatgcctatgacaaggggcgcctg
atgggcacgtttgcggaagattgcgccgaggcctaccagttcacgcgcgaggcgcaggac
gcatttgcgatatcctccctgacccgcgcgcagaacgcgatcaaggatggtctttttgcg
gcggaaatcacgccggtcaaggtcaagtccggccgcgccgaggtggaagttaccattgac
gagcagccaggcaaggcaaagctggacaagatccccacgctgcgccccgccttccgcgaa
ggcggcacggtaacggcggccaattcctcttccatttccgatggcgcggcagcacttctg
ctcatgcgcgcatcggaggcagaaaaacgtggcctcaccccgcgcgcggtcatcaccggc
catgcaacctatgccgacaagccaaatctcttctccacggcccccattggcgcgatccgc
aaactgtctgaaaagactggctgggatttgaaggatgtcgatctcttcgagatcaatgaa
gcctttgccgttgttgccatggccgccgtgcgcgatctcgacctgccgcacgacaaggtc
aatattcatggcggcgcctgtgcacttggccaccccatcggcgcatcgggcgcacgtatt
ctcgtaaccctgctggcggcacttgaaacacatggcctgaagcgcggcatcgcgggcatc
tgccttggcggcggcgaggcaaccgcaatgggtatcgaaaggatcatctga

DBGET integrated database retrieval system