KEGG   Brucella melitensis M28: BM28_B0427Help
Entry
BM28_B0427        CDS       T01852                                 

Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bmz  Brucella melitensis M28
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BM28_B0427
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BM28_B0427
   00620 Pyruvate metabolism
    BM28_B0427
   00640 Propanoate metabolism
    BM28_B0427
  Energy metabolism
   00680 Methane metabolism
    BM28_B0427
Enzymes [BR:bmz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BM28_B0427
Lipid biosynthesis proteins [BR:bmz01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BM28_B0427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(419186..420088)
Genome map
AA seq 300 aa AA seqDB search
MTGPLLLGVPTILNEGGFTAENTYDIIERLGVTSLAGSPTAFRLLMAAGPESAARVKGRL
RVASSAGEPLNPEVIRWFDACLGAPIHDHYGQTELGMVVNNHHGLEHPVRQGSAGYAMPG
YRVAVLDEAGKEVGPNEPGVLAIDIDNSPLLWFTGYYKKDTPSISGGYYRTGDTVEFEPH
GSISFIGRADDVITSSGYRIGPFDVESALLEHPAVNEAAVVGVPDPQRTEIVKAFVILAP
GFEGTPELAEELALHVKKQLSAHAYPRQIDFVAELPKTPSGKIQRFLLRKAEVEKQQQQN
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggtcccctgcttctgggtgtgccgacgatcctgaacgaaggcggtttcaccgcc
gaaaacacctatgacatcatcgaacgcctcggcgtgacgagccttgcgggctctccgact
gccttccgcctgcttatggccgccgggccggaatctgctgcccgcgtcaagggccgcttg
cgcgtggcatccagcgcgggcgagccgctgaacccggaagtcattcgctggttcgatgcc
tgtcttggcgcgccgatccacgatcattacggccagacggaactgggcatggtggtgaac
aaccatcatggattggaacatccggtgcggcagggttcggcgggctatgccatgccgggc
tacagggttgcggttctggatgaagcgggcaaagaagtcggccccaatgaaccgggcgtt
ctggccattgatatcgacaattcgccgcttctctggttcaccggctattataaaaaggat
acgccctccatctccggcggatattatcgcaccggcgatacggtggaattcgagccgcat
gggtctatcagcttcatcggccgcgccgatgacgtcatcacctcctccggctatcgcatc
gggcctttcgatgtggaaagcgcgcttctggaacatcctgcggtcaacgaggctgcggtg
gtcggcgttcccgatccgcaacgcaccgaaatcgtgaaggcctttgtcatcctggccccc
ggcttcgagggtacgccggaactggcggaagaactggcgcttcacgtcaagaaacagctt
tccgcccatgcctatccgcggcagatcgactttgtggcggagcttcccaagacgccgagc
ggaaaaatacagcgcttcctcctgcgcaaggcggaagtcgaaaagcaacagcaacagaat
tag

DBGET integrated database retrieval system