KEGG   Brucella melitensis M28: BM28_B0572Help
Entry
BM28_B0572        CDS       T01852                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bmz  Brucella melitensis M28
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmz00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BM28_B0572 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BM28_B0572 (pyrB)
Enzymes [BR:bmz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BM28_B0572 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:564897..565865
Genome map
AA seq 322 aa AA seqDB search
MTNQTVSPLFPHRHLLGIKGLSPLDILCLLDLADQEIAVSRQPEKKKSVLRGRTQINLFF
EASTRTQSSFELAGKRLGADVMNMSVGNSSVKKGETLIDTAMTLNAMQPDILVIRHASAG
AAALLAQKVGCSVVNAGDGAHEHPTQALLDALTIRRAKGQIENLIVAICGDVLHSRVARS
NILLLNALGARVRVVAPSTLLPAGMADMSVEVFNSMEEGLKDADVVMMLRLQRERMAGSF
VPSVREYFHFYGLDREKLKFAKPDALVMHPGPMNRGVEIASDVADGPQSVIQQQVEMGVA
VRMAVMEALLDPRRNPGNGEPA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcaaacggtctctccgcttttccctcaccgccacctgcttggcatcaagggg
ctatcgcccctggacattctctgccttctcgatcttgccgatcaggaaatcgctgtctcc
cggcagccggagaagaaaaagtccgtgctgcgcggtcgcacgcaaatcaacctgttcttt
gaagcatcgacacggacgcaatcttcgttcgagctggccggaaaacggctgggcgcggat
gtgatgaatatgtccgtcggcaattcatcggtcaagaaaggcgaaacgctcatcgatacg
gcgatgacgctgaacgccatgcagccggatattctcgtcatccgccatgcttccgccggt
gctgccgcccttctcgcgcagaaagtgggttgctcggtggtcaatgcgggcgacggcgcg
catgaacaccccacacaggcgcttctcgatgcgctgacaatccgccgcgccaagggccag
atcgaaaatctgatcgtcgccatctgcggtgacgttctgcattcgcgcgtggcgcgctcc
aacattctcctgctcaacgcgctcggcgcgcgggtgcgggtggttgcgccttcaacactc
ctgcccgccggcatggccgatatgagcgtggaagttttcaactccatggaggaggggctg
aaagacgctgatgtcgtcatgatgctgcgcctccagcgcgagcgcatggcgggttccttc
gtgccttccgtgcgggaatatttccatttctatggcctggaccgggaaaaactcaaattc
gccaaacccgatgcacttgtgatgcatccggggccaatgaaccggggcgtcgagattgcc
tccgacgttgcggacgggccgcaaagcgtcatccagcaacaggtggaaatgggcgttgcc
gtgcgcatggccgtgatggaggctctgctcgatccgcggcgcaacccaggcaacggagaa
ccggcatga

DBGET integrated database retrieval system